SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032995 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032995
Domain Number 1 Region: 121-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000188
Family C-terminal domain of adrenodoxin reductase-like 0.076
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032995
Domain Number - Region: 140-155,233-293,373-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00123
Family FAD/NAD-linked reductases, N-terminal and central domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032995   Gene: ENSTRUG00000013006   Transcript: ENSTRUT00000033121
Sequence length 496
Comment pep:novel scaffold:FUGU4:scaffold_538:47545:49782:1 gene:ENSTRUG00000013006 transcript:ENSTRUT00000033121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERWNATAQTSLCLCPPGNGPSGICLSYLLSGYTPYLSPDASHPNPLLQSKLGEQPHLSL
LEQDLEYLCEGLEGRSSNPVAVLFDSLLLPDSDFGLDRVSPLEWRYEPEHAIPHLVLGKG
PPGGAWHAMEGSMLTLSLANWMELPGLKLKDWMRDKRRNVRNDRATPAEIASYYQHYVSQ
MSLEQNFAGGTTVTSVTRQSSPQDGAPPCWRIQGLQRRTAASAPEAVPFSVLAHNVVLAT
GTHDIPARLGVEGESLPFVHHSFWELEAAICRGELSQTSDPVLVVGAGLTAADAVLATHH
LNTPVYHAFRRSVTDRQLIFNQLPKLLYPEYHKIHQMMTRQQYQPDPDPDPDPDRAQNPH
GHPSPSLHANSSPSASYSGYLSFPRCKVVKFHPDRKCVLELDSGQQIVVQISKALVLIGA
HPNLSFLRDNGRPLGVDPNETITCRRNPIEVDPFTNAVVAAEGPGMYAMGPLMGENFVRF
LKGGALAITSDLNKKR
Download sequence
Identical sequences H2U7S9
ENSTRUP00000032995 31033.ENSTRUP00000032995 ENSTRUP00000032995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]