SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000033077 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000033077
Domain Number 1 Region: 18-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.23e-36
Family G proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000033077   Gene: ENSTRUG00000013035   Transcript: ENSTRUT00000033203
Sequence length 423
Comment pep:novel scaffold:FUGU4:scaffold_36:913726:918035:1 gene:ENSTRUG00000013035 transcript:ENSTRUT00000033203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLMANCCSWFRRWRKPKRNVTLIMLGLDNAGKSATVQGIQGEDPQDVTPTVGFTRIEM
KQDKFQVTIFDLGGGKRIRDIWKNYYTMSHGVVFVVDSTDIDRIHETKETLAEVLGHPCI
SGKPVLVLANKQDKQEALYESDITERLSLEQLVNKYKCRCNIVPCSALRSYGKMADKSIK
KGLKWLLNTINLDYEIIAERVSKDTAEQQAQEERYKKERAERVRLIREEREREEREMAER
EGRQILEEDCDEENIQSPFQPISNVISVRMNKDTVQENSSTRTDADQESYDNDGEATHRR
KTPEDSHSGKKEMFTALGSYMDSLPCWISYDLNTFVSSTAGKQDVKNVRSLFLKRKHRVE
PLNTGDGPAMSESSPPGLMVGLAKSKLPSLPKLEKRHSKFYKKPLPPLVSRQKPNGEAHD
VIT
Download sequence
Identical sequences H2U811
ENSTRUP00000033077 ENSTRUP00000033077 31033.ENSTRUP00000033077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]