SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000033505 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000033505
Domain Number 1 Region: 230-306
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.29e-26
Family GAS2 domain 0.00018
Further Details:      
 
Domain Number 2 Region: 18-68,101-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.84e-25
Family Calponin-homology domain, CH-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000033505   Gene: ENSTRUG00000013171   Transcript: ENSTRUT00000033631
Sequence length 681
Comment pep:novel scaffold:FUGU4:scaffold_50:482884:496519:-1 gene:ENSTRUG00000013171 transcript:ENSTRUT00000033631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQSNIQSAASKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLDITADTFMDALETGCALC
RHANNVNRAAQDFQLEYPEAAHAMKVPSKDVVFQSRNVVSGSFLARDNVSNFISWCRQEL
WIKDVLMFETNDLVERCNEKNFVLCLLEVARRGSKFGMLAPMLIQLEEEIEEEIRDQECQ
RIDTEVPPEQSPPSSRRFSGKESRKDVEDEGEPDPEPFIWPQKRVLCDMRNLDELVREIL
GQCSCPAQFPMIKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRC
AAFAHRYHQAKASGQGQGGHSKSSSAHSSRSTSPGPLCDFRSQRTVMMPNEIMWTWERPF
YFLPNKETMLPLSRRLSGDSDSSTASSKGGGGGGGGGGSSDGSRTSRTERGRSLGNDGPR
RFHAPRSHSQSKLSTRANDASLGPASCFKDPQPPPSDRKEDLRAKQAPPASPRLGRRSPH
SSPRNSHHHPTRSARTLQGPRSIGRGQPRNWAGPEHQESEEEDVTPGFQMLPTIDPQREQ
DLYRSFEAEFLANSQQARGVLSRVPAGAILQGSLTSSGPAPANSNVTDSAYSSSNSSTSS
LNVGAKMGTLPDLSLSESYSESPQPSSPVANGDAHREAPSAKKGQKKGDKLDSLAKPKPR
AKIRPRIDNWPENCPTRIPTP
Download sequence
Identical sequences H2U989
ENSTRUP00000033505 ENSTRUP00000033505 31033.ENSTRUP00000033505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]