SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034507 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034507
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-31
Family Calponin-homology domain, CH-domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 181-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000493
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034507
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0067
Family LIM domain 0.027
Further Details:      
 
Domain Number - Region: 688-722
Classification Level Classification E-value
Superfamily XseB-like 0.0314
Family XseB-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034507   Gene: ENSTRUG00000013527   Transcript: ENSTRUT00000034633
Sequence length 858
Comment pep:novel scaffold:FUGU4:scaffold_15:824951:830314:-1 gene:ENSTRUG00000013527 transcript:ENSTRUT00000034633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIKALEQWCRAHCDGYRDVTITNMTTSFRSGLAFCALIHNYRPDLIDYDSLRKEDVFE
NNRLTKAFQVAEEKLGIPALLDAEDMVALKIPDRLSILTYVSQYYNYFNGRPPMGGVKRP
AENFREAPSGKKNLPVVAGTFMPRPTTEIRLPPAVNTRSSSKGDDVPVETAESGNKSGTL
NSKCAACKCHVHLVQRHFVEGKLYHRSCFKCWECSSVLHAGGYRPGNQPGTFVCNQNSCK
GSSSVSPGRPSSSGETEPARRPSSVLLAPLRAPVEPVGPSPPSKSWTASAQKTQSARQRF
FQADVTTGDATPTELSKEGGTTTVKTLAEENRNNNNKRPFTVRPADRRFGGDPVSPNGPS
SRNGNQVQASARRWVGDPSDKECPRETDATGSRPTAVRSDAKGNPSQLFSILLSDSRPTR
CPHFPQLSPSVCIHRKQSLFVTAVPFTQPLHLAALKNELCDPSRRSPGNAVHARVEPPDI
KYSSAVSQRRSNPPPQPKSGAKSSYVQHVSPPADIETLNLSQDPRPLVSLHQAAPSLRHP
QQQLQSVLFSYQDPGGRAPPATLGPETPPGRSLHGQDSIPFVPPGFKCGSQHPVKPPPRR
PAVESISVLSRVPANPGNPPGLIKNIAIPAINTRERPRPSRQQSSRTRNEPGIALKKKGR
ASSHLSSPSLEFQSVRSRLEVKPYHVPAEQIERQLGEIETNVARLEKEGVALEKNLRSCE
EGDGDILMDPLMVDWFNLIRKKQMYIRKESELVYLARTQELEQQQPGVEGELRRLLEKPD
HLKSREEQRQEERLMQRLVEIVDGRNAIVEGLDEDRLREVEEDQQLNEMMKNLGVKKAKH
KRRRSKRWQPGPAASPGS
Download sequence
Identical sequences H2UC39
31033.ENSTRUP00000034507 ENSTRUP00000034507 ENSTRUP00000034507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]