SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034885 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034885
Domain Number 1 Region: 191-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-52
Family DBL homology domain (DH-domain) 0.000000141
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-544
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 4 Region: 643-755
Classification Level Classification E-value
Superfamily SH2 domain 8.58e-24
Family SH2 domain 0.00065
Further Details:      
 
Domain Number 5 Region: 785-852
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 6 Region: 594-672
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000287
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034885   Gene: ENSTRUG00000013652   Transcript: ENSTRUT00000035013
Sequence length 854
Comment pep:novel scaffold:FUGU4:scaffold_40:1006895:1015383:-1 gene:ENSTRUG00000013652 transcript:ENSTRUT00000035013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAAWLIECRVLPDNHRVTWENAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLGVCLAKFYLKKSDLFEAFDLFDVRDFGKVIDTLSILSHSHV
ATQRGLQSFPIEGSNLDEEIYSGLSDYIDETLDEDDDLYDFVEDEEDKGDEIYEDLMKIE
EPPERQKCGVDKRECCLQEIRQTEEKYSETLESVMQHFRKPLERFLQPQDIESIFSNIED
LAKIHRSLLGEVRASILNYGARNLYQVFLDYKERLLLYGSYCSQVEMATKHLDKLSSQRE
DIRMKLEECSNRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDAKDKENLRLALDA
MRDLAQCVNEVKRDNEIIRQITTFQLSIENMTHSLALYGRPKIDGELKICTPEKKSKHDR
FAFLFDKAMFVCKKKSGETFELKEIIELQSYQIRDEPSGEKDNKKPEQWSHVFLLLDVYG
GTGYDLYFKTRELKKKWLEQFEMALSNLCPENSTANRHDFQMHCFEGTASCKACSMLLRG
IFFQGYRCTRCKMAAHKECLGRVDVCGRNSESIGTIKKHSTVNILMLFATQRSSGYVNPG
FPKMEVCQDYYGLPPPPVGFGQPLHLSKGDIVELTRADADLSWWEGRNLGVGHIGWFPCQ
RVQPYVPRPTPDLSDFPWFAGNLDRAAAKNLLTPRSDGTFLVRQKDGGEFAISIKFNMDI
RHIKITTNDGLFRINDKKAFRGLLELIQFYRQNSLKEYFKEVDTALCTPFKQSEKSNSTN
STSTTPNTTPRGSVKGLSVARARYDYSARDRSELSLQEGDTIKIISKKGHSGWWKGEVYG
RVGLFPANYVDEDF
Download sequence
Identical sequences H2UD66
31033.ENSTRUP00000034885 ENSTRUP00000034885 ENSTRUP00000034885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]