SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034912 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034912
Domain Number 1 Region: 966-1093,1125-1330
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.51e-76
Family p120GAP domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 34-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-37
Family Calponin-homology domain, CH-domain 0.0000265
Further Details:      
 
Domain Number 3 Region: 1560-1657
Classification Level Classification E-value
Superfamily RGC domain-like 1.57e-32
Family RGC domain 0.00000666
Further Details:      
 
Domain Number 4 Region: 625-831
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000159
Family Motor proteins 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034912   Gene: ENSTRUG00000013665   Transcript: ENSTRUT00000035040
Sequence length 1657
Comment pep:novel scaffold:FUGU4:scaffold_1:749266:774897:1 gene:ENSTRUG00000013665 transcript:ENSTRUT00000035040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSEETDGLRPRYGSVLDGVERLTAEEMDERRQQNMAYEYLCHLEEAKRWMEACLDEEL
PPTTELEEGLRNGVYLAKLGNFFAPRTVSLKKIYDREQTRYKVELYRHTDNVIQWLNAMA
EKGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINN
MKSELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDQGVPEGTLAAMQNPN
AMLVNLDPGSAHHYHNTLYQAKGEKVANSRKRQMENIDAERDIYDELLTQAEIQGNVNKV
NVATAINAAEQAILNGDEEKLYEALKAVGVQNLQPQNKGWYLKQLRAERESKEQQASPGE
ALTRDELQSGVDVANEIAESYQKLLKAVERINAAIRAGFPEKTVEELMNPQAQLPEVYPS
AADLYQRELASLQQQSPELTLSHPELLVAVEMLSSVVLMNQAMDAGDRAALWRQLSSPVT
GLSNVEDNYAQRYMDELVRLKATAREQGCDYLTWNDIQACVDQVNFTVQEEHERIAAIGQ
INEALHEGDSLKTLAMLQNPAAKLTDVDPSVAQHYHDKLLEARREKAHETEDPSAALWLD
EIQDAILKANQDTQEALQFSRAIQTINEAVNVGEPVQTLAALRNPGTGLYGVTSECAQTY
QDDLVKVKNQKNAEGDNGSEWVKHWVKGGHDYYYNLNTKEGTWVEPEGFLQNNTRLNKDD
IQAVVSGVTTAYNREQLWLANETLITKLQARCRGYLVRKGLKERMEYLKSNEAAVTNIQA
HWKGYKQKRKFNDRKQYLKDHSDEAVKIQSMVRMHQARKKYRDRLKYFRDHINDVIKIQA
FIRANKARDDYKTLTSAEDPPMGVVRKFVHLLDHSDQDFQEELELMQLREEVITNIRSNQ
QLENDLNLMDIKIGLLVKNKITLQEVVSHSKRLTKKNKGQLSNMMMMNKQRGGLKALSKE
KRLKLEAYQYLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLK
LFKTALKEEIKSKVDQMKEIVTGNPTVIKMVVSFHRGARGQNALRQILAPVVKEIMDDKA
LNIKTDPVDIYKSWVNQMETQTGEASKLPYDVTPEQAMSHEEVRTRLEASIKNMKTITDK
FLSAIIVSVDKIPYGMRFISKVLKDSLQEKFPDATEDELLKIVGNLLYYRYMNPAIVAPD
AFDIIEVSAGGQLTTEQRRNLGSVAKMLQHAASNKMFLGDNAHLNPINEYLSASYQKFRR
FFLAACDVPSLEDKFNVDQYSDLVTVSKPVIYISIGEMINTHTLLLDHQDAIAPEHNDPI
HELLEDLGEVPTVESLIGENPLPPDDPNKELMGKTEVSLTLTNKFDVPGEANVEMDAKTL
LLNTKRLIVDVIRFQPGETLTEILDSTASPEQEAEYQRAMQRRAIRDAKTPEKMKQVKPV
VDDSLTLQGKKDKIKSNLQRLAELGKVDPQNRYQDLINDIAKDIRNQRRYRQRRKAELVR
LQQTNAALNTKTKFFNVQIDSYNQYIKACMDNLASKGNVFLLRLSQKPGSNKAKKSKQVS
QKYTASRLHEKGVLIAIEDLQPNQFKNVIFEISPSEAVGVFDVKAKFMGVHLETLQIEYQ
DLLQLQYEGVAVMKIFDRATINVNLLIFLLNKKFYEK
Download sequence
Identical sequences H2UD93
ENSTRUP00000034912 ENSTRUP00000034912 31033.ENSTRUP00000034912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]