SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035307 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035307
Domain Number 1 Region: 182-252
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-18
Family Homeodomain 0.0000608
Further Details:      
 
Domain Number 2 Region: 57-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000401
Family LIM domain 0.027
Further Details:      
 
Domain Number 3 Region: 27-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000015
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000035307
Domain Number - Region: 120-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000623
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035307   Gene: ENSTRUG00000013818   Transcript: ENSTRUT00000035435
Sequence length 364
Comment pep:novel scaffold:FUGU4:scaffold_18:2098415:2101832:1 gene:ENSTRUG00000013818 transcript:ENSTRUT00000035435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVTVDLTSPYCEDMGDMGDPPKKKRLVSLCVGCGNQIHDQYILRVSPDLEWHAACLKCAE
CSQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCNIGFSKNDFVMRARSKVYHIECFRC
VACSRQLIPGDEFALRDDGLFCRADHDVVERASLASGDPLSPLHPARPLQMAAEPVSART
PALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRV
WFQNKRCKDKKKSLLMKQLQQQQTNDKTVRCHIRSPFSTVTQAMKPDPDSDNFVSKSLTG
RVGLGWGSSSQRDDIIDREVNLQTVMVSFSEGGPGSNSTGSEVASMSSQLPDTPNSMVSS
PIEA
Download sequence
Identical sequences H2UED8
ENSTRUP00000035307 ENSTRUP00000035307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]