SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035684 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035684
Domain Number 1 Region: 112-409
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.28e-71
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000134
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035684   Gene: ENSTRUG00000013955   Transcript: ENSTRUT00000035812
Sequence length 422
Comment pep:novel scaffold:FUGU4:scaffold_612:23302:27910:-1 gene:ENSTRUG00000013955 transcript:ENSTRUT00000035812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTPMTREEEEELREAFAKIDVDNNGFISKDELNHLFQAANLGLPGYRVREIVQELMK
SSDQLTFDQFTQVVHGLRSSEVAKTFRKAINKKEGICNVAGTSEQSGTQHSYSEEEKVAF
VNWINKALEKDGDCKHVLPMDPANNDLFTAMGDGIVLCKMINLSVADTIDERTINKKKLT
PFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSKNE
GLFPLVGFKAQTLLKLGALPPPLSLSHTHTHTHTHTHTHTGFKDSKAYYNLLNQVAPKGD
EDGVPPIAIDMVNDLNQEKDDLRRAECMLDQAERLGCRQFVMATDVVRGNPKLNLAFVAN
LFNKYPALKKPENQDIDWSAIEGETREERTFRNWMNSLGVNPRVNHLYTVSETSTALVIF
QL
Download sequence
Identical sequences H2UFG4
31033.ENSTRUP00000035684 ENSTRUP00000035684 ENSTRUP00000035684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]