SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035696 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035696
Domain Number 1 Region: 121-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.4e-157
Family Calponin-homology domain, CH-domain 0.00000000355
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily EF-hand 1.13e-16
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035696   Gene: ENSTRUG00000013960   Transcript: ENSTRUT00000035824
Sequence length 628
Comment pep:known scaffold:FUGU4:scaffold_6:1382833:1391612:-1 gene:ENSTRUG00000013960 transcript:ENSTRUT00000035824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSIAGKKMSGRITAEEIEEMRAIFADVDLDKDGHICDYELHELLKSVGHTKPGYMVRDI
IQKLDRDSDNKISFQEFLSIVQELRSSEIAKTFRTVLNRKEGILAIGGTSQLSSEGTQHS
FSEEERFAFVNWINTALEKDPDCQHVLPMDPNTDSLFKAVGDGIVLCKMINLSVPDTIDE
RTINKKNKTTFTIQENLNLALNSASAIGCHVVNIDASDLMEGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLREGETLADLMKLSPEELLLRWANFHLENAGCQPIRNFSGDIKDSK
AYFHLLNQISPKGTEEDQPRIDINMSGLSELDDRNRAEAMLVQADRLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENEDVDWQMLEEETREERTFRNWMNSLGVNPHVNHLY
SDLQDSIVIFQLYDKIKVPVDWNKVNKPPYPKLGTNMKKLENCNYAVDLGKSANFSIVGI
GGHDLNTGVPTLTLGLVWQLMRRYTLNVLEELGGGDKSDGIIVNWVNKTLAEAGKSTKIS
SFKDKEISTSLAVLELIDAIQPNSINYDLVKTGALSEDEKLENAKYAISMARKIGARVYA
LPEDLVEVNQKMVMTVFACLMGRGMKRI
Download sequence
Identical sequences H2UFH6
31033.ENSTRUP00000035696 ENSTRUP00000035696 ENSTRUP00000035696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]