SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036137 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036137
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000873
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036137   Gene: ENSTRUG00000014125   Transcript: ENSTRUT00000036268
Sequence length 75
Comment pep:novel scaffold:FUGU4:scaffold_24:898005:898378:1 gene:ENSTRUG00000014125 transcript:ENSTRUT00000036268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQELTEEELQDLYAWLDKIPLSRPKRHITRDFSDGVLAAEVVKHFLPKLVDLHNYTPAN
STQQKLTNWDVLNRR
Download sequence
Identical sequences H2UGR6
ENSTRUP00000036137 31033.ENSTRUP00000036137 ENSTRUP00000036137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]