SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036192 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036192
Domain Number 1 Region: 10-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.37e-42
Family G proteins 0.0000275
Further Details:      
 
Domain Number 2 Region: 209-248
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000183
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036192   Gene: ENSTRUG00000014146   Transcript: ENSTRUT00000036323
Sequence length 306
Comment pep:novel scaffold:FUGU4:scaffold_62:777145:778731:-1 gene:ENSTRUG00000014146 transcript:ENSTRUT00000036323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQSSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSAESPYAYSSGEHLIISLSCCFA
IKHKGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNGWSFD
GIDRWIREIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNSMTFFEVSPLCNFNV
IESFTELSRIVLMRHGMEKFWRPNREFIVFSLQDLCCRSIVSCTPVHLIDKLPLPVAIKS
HLKSFSMANGMNAVMMHGRSYSVANSAASGSGGSKANSLKRSKSFRPPPSPPKNSSSSSK
RNCKIS
Download sequence
Identical sequences H2UGX1
ENSTRUP00000036192 31033.ENSTRUP00000036192 ENSTRUP00000036192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]