SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036209 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036209
Domain Number 1 Region: 87-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-28
Family Extended AAA-ATPase domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036209   Gene: ENSTRUG00000014153   Transcript: ENSTRUT00000036340
Sequence length 436
Comment pep:novel scaffold:FUGU4:scaffold_122:860070:862278:-1 gene:ENSTRUG00000014153 transcript:ENSTRUT00000036340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMMLPSAFLKDLKEAQSNYTDFWKCRNEQTNFNQRHDVELMKEEQRKVVEAEIRKQVDEE
MRQELAKLKLVVDKEKGGKGTAKKKKGAKSGKKKKKEKDLTSDRTLESLCEELVQQRLLK
LPNNHRIQEFLGDYSYLGTTLRQNDTEPMPSLSDVRQVVSLYAVLPLGSQAIHEKAPLIK
AILLAGPSGVGKKMLVHAICQETGAALFDLSPLNTAGKYPGKAGLTMMLHMVFKVAKLLQ
PSVICIEDAEKIFYKKVPKEEKELDPKRLKKDLLKSLKLIKGEDRVLIVGTTKDPQSAEI
KSFCKMYSKIILIPRPDYGSRCILWKKLIQKQGGVITAALDLSSLAKLSDGYTPGHMVQV
IQSVVTKHRIFQQETKPLTAAEFVAPLAKIDPIFQEEEEAFKNWYTKTPMGKKRAKAATG
NDDEPLVEAKAPKKKK
Download sequence
Identical sequences H2V846
ENSTRUP00000036209 ENSTRUP00000045385 ENSTRUP00000036209 ENSTRUP00000045385 31033.ENSTRUP00000036209 31033.ENSTRUP00000045385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]