SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036767 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036767
Domain Number 1 Region: 14-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-58
Family G proteins 0.0000000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036767   Gene: ENSTRUG00000014380   Transcript: ENSTRUT00000036898
Sequence length 181
Comment pep:known scaffold:FUGU4:scaffold_68:1203940:1206729:1 gene:ENSTRUG00000014380 transcript:ENSTRUT00000036898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAFSALFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCTEAREELSRMLNEDELRDAV
LLVFANKQDLPNAMNAAEVTDKLGLHQLRSRNWYIQATCATSGDGLYEGLDWLSNQLKNK
S
Download sequence
Identical sequences H2UIJ6
ENSTRUP00000036767 ENSTRUP00000036767 31033.ENSTRUP00000036767 XP_003975384.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]