SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036975 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036975
Domain Number 1 Region: 189-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-50
Family DBL homology domain (DH-domain) 0.0000000275
Further Details:      
 
Domain Number 2 Region: 381-505
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-32
Family Pleckstrin-homology domain (PH domain) 0.0000197
Further Details:      
 
Domain Number 3 Region: 106-178
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-24
Family SH3-domain 0.0000491
Further Details:      
 
Domain Number 4 Region: 6-64
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000001
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000036975
Domain Number - Region: 751-797
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036975   Gene: ENSTRUG00000014456   Transcript: ENSTRUT00000037107
Sequence length 811
Comment pep:novel scaffold:FUGU4:scaffold_42:1005857:1020574:1 gene:ENSTRUG00000014456 transcript:ENSTRUT00000037107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQIYQEPKNDGECLYNIKEFLKGCTSFRVEPFEASDLLLGLNFSKVLSSLVALNKVTAD
ISVGSDSVSARHSSSHRIKSFESLSCQTSLGRSSKLLQNQFRSLDMSENSGQQLLVKARF
NFQQTNEDELTFTKGDIISVSRQEEGGWWEGTLNGRTGWFPSNYVREVKGSDKQVSPKSG
TLKSPPKGFDTSAISKTYYNLVLQNILETETEYSKDLQSLLTNYLRPLQNTDKLSSSDVA
LILGNLEEICTFQQMLVQSLEECTKLPESQQRVGGFFINQMPQMKALYNSYCSNHPSAVN
VLTQQSEVLGEFMEGRGAVSPGILTLTTGLSKPFMRLDKYPTLLKELERHMEEGHPDRPD
IQKCMAAFKSLSVQCQEVRKRKELELQILTESIRLWEGDDIKTLGSVLFMSQVLVQSPGS
EEKSERYLMLFPHVLLMLSASPRMSGFIFQGKLPLAGMTVSKLEDCDAHKNAFELNGTMF
DRLQVICTHKQDLQDWVELLSRQIKHTAATAPSHKPLTVPCHTLPSHPVTLSRHAEGKAM
TVAPTYHTLPHPSSHGTSLSSTMMWGPLEPPNTPKPWSLSCLRPAPPLRPSAALCYKEDL
SKSPKSVKKLLPKRKPERKQSEEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNST
WQGTDLMHNHVLADVDRSCMDLPGRRSSVSRPELSSDLSEDSDYDSIWTSHSYRMGSVPR
PRTEMGLHVIIPGEKKVQGEGPSRNGQSADEEKSLVDVVYALRDEVQELKQENKKMKRSL
EEEQRARKDLEKVVRRVLKSINDPTWDETNL
Download sequence
Identical sequences H2UJ54
ENSTRUP00000036975 ENSTRUP00000036975 31033.ENSTRUP00000036975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]