SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037158 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037158
Domain Number 1 Region: 9-372
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-121
Family Motor proteins 0.000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037158   Gene: ENSTRUG00000014533   Transcript: ENSTRUT00000037292
Sequence length 1066
Comment pep:novel scaffold:FUGU4:scaffold_33:1548146:1586004:-1 gene:ENSTRUG00000014533 transcript:ENSTRUT00000037292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADANAECNIKVFCRFRPLNKHEISRGDKFLPIFQREDTVIFAGKPYVFDRVFPTNTTQE
EVYNTSAKQIVRDVLGGYNGTIFAYGQTASGKTHTMEGNLHDSQGMGIIPRISEDIFEHI
FAMDENLEFHIKVSYFEIYMDKIRDLLDVTKTNLSVHEDKYRVPYVKGCTERFVTSPEEV
MDVIDEGKLNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLCGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSHVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDVESKSTLMFGQRRAKTIRNTVTVNLELTAEQWKKKYEKEKEKNRSMKDT
IQRLEAELEQWRSGEDVVLERLQSESQEDPLVSGESEEPLLDICSPCSSCSLASSIVVHI
SEEERQKYEEEIRKLYKQLDDKDDEINHQSQMVEKLKEQMLKQEELLASSRGDSERVQSE
LCRLQTENDSAKTEVKEVLQALEELALNYDQKSLEVEEKSVQNKLLAEELAKKMVGLKQT
HLVALEVELSRIQEVSSHQRKRIAEILNGMMRDLSEFSTIVGNRDIKLPVEITGAIEEEF
TVARLYINKIKSEVKSMVKRCHHLEALQTECHRKMEETGRELSSCHLLISQHEAKTRSLT
EYTQNLELKKRRLEESYDSLSEELAKLQAQADHISVAQKPPLSGTHSAWLCCSISVSCSV
CLETMSELTRGKNHSAVQESCDIKRALEQQMESHREAHSKQLGRLRDEINEKRKIIDDLT
DCNQEQRLELEQLRSDYEHLRTQERHKSRQLEDLTYLHERHEQSKQDLKGLEETVARELH
TLHSLRKLFVQDLSIRVRKSAGMEPDDSVGYITQKQKIFFLENNLEQLTKVHKQLVHDNA
DLRCELPKLEKRLRTTAERVKALEGALKEAKEGAMQDRHRYQQEVERIKDVMRARYPFRR
PHAAQIGFQLKRRVKPISAPLSSSIPKTGTPQISMTTVPLSSLCTAVECIWVLVGSPART
ASQIPGLAALHPGCRTHATRHHRQNGGGNCSTSKNRQDALFFSVRK
Download sequence
Identical sequences H2UJN7
ENSTRUP00000037158 ENSTRUP00000037158 31033.ENSTRUP00000037158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]