SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037515 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037515
Domain Number 1 Region: 1361-1499
Classification Level Classification E-value
Superfamily PRC-barrel domain 4.32e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000143
Further Details:      
 
Domain Number 2 Region: 249-341
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000222
Family Calponin-homology domain, CH-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037515   Gene: ENSTRUG00000014682   Transcript: ENSTRUT00000037650
Sequence length 1500
Comment pep:novel scaffold:FUGU4:scaffold_73:1092250:1110640:1 gene:ENSTRUG00000014682 transcript:ENSTRUT00000037650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADDRGMRRTFIVPAIKSFDHYDFTRAKISCSLTWLVAKAFGSDAVPEELAEPLYRD
QYNQEHLKPTVASLLQSAELYCRAGSLILRSDAVKPLLGHNAVIQALAQKGLYVTDQDRL
VTERDLTSLPIHMSSHLAFIDTLMMAYTVEMVSVERVMSSIGRYTSAEQSHGEGHLQELP
YDTEDAIVTWINKVNEHLRDIMVEEQKLRDQFHESHSSAQKSPNKWYWKLVPARYRKEHA
QQRSAPSLPLVENLLKDNTDGCALTTLLHFYCSTVIRLEDICLKETMSLADSLYNLQLVQ
EFCKNNLNHCCHFTLEDMLYAHASIKSNYLVFMAELFWWFEVVKPSFVQPRILDTNGTQL
LKNVCHRPPSTDASLSSHQPVSQYPPTEKWLPCPVLSNSDVHTDLRVQTPSKQATGSIKR
STSLSFMDGCIGTWPKEKRSTARGISFEIPLDGEPTVPPSESPSLSGMTRSASSEGLGFK
VHFATHGGLRRHPSAIPVNVNGQSSHILEEDEDFTSPKPLGRNNTFSVKNQNRCSSIYSP
HSGNNHHGDHSGHISPSTPPSIEEALKIIHDSERPHASLGMGGGDGFFLHDAEPLEPSGA
RGEGDDTGSAKTRLNDHEPNSVSTDEVDTGIHVRTEDIQSLDEDSSSLRDYSDMDPDCEA
MTRSCPNDDRPDRERNKTSPCPSSAPTLPRSHTMSPASSSTGSVSGLVRMTSFAEQKFRK
LEGRSSGGTTPESSDLNVPYTHSTKSTFSPVVTPSPRDPSHLIASEMIQLRMKLEEKRRA
IEAQKKKVEAAFTRHRQKMGRTAFLNVVRRKGINVPVSPNSGGAETPSSEPITPSMETSQ
GGVERAERCKPDGAAPKSPSEDRIKCPINEPDLTGYHLTDPHVSRGDSGVTPGEADLADY
TRSIERLNTSLGFLQTEMQRLAQQQEKIMAMREQQQQQAWVIPAPAPSPHRQLRELRSSS
VTGRGSGRGSVGSLSPNLSSSGSPHAPNRSPAGIKRRPASFHARTPRTPRPNDLKVTPFS
RMLNTPTSVDSLPRLRRFTSSQSQLSSFAYLGNETSSGEKKDSKEGKAADESAGTSHPSA
NQHNKAECENERNQTARPRSKGEDKSRRSEEVLHQPLPEYKRPTSSQVKAENQDRKDLVE
VPLSELKPPERLSSGQEMDGEEDGDAGGDDQKLCCGFFFKDDVKGEEDMAAKKAALLEKR
MRREREAREKKQQQELDQEQEKEAARLKTEEEQQKKEDEKARREYIRNEYLRKKQLKLME
DMDEVIKPRSGSLKKKPRPKSIHRDVVDSSMPPMRATGYSVSSVSLASLNLADNDRDLPN
NRKNNRPESAGGFSSCPSTVSRNGEKDWENDSTTSSSPSNTEYTGPKLYKEPSAKSNKHI
IQNALAHCCLAGKVNEGQKNKILDEMEKSGANNFLVLFRDAGCQFRSVYTYCPETEEITR
LAGIGPKSIKIKMIEGLYKYNSDRKQFSQIPAKTMSASVDAITIASHLWQTKKQWTPKKL
Download sequence
Identical sequences H2UKP4
ENSTRUP00000037515 31033.ENSTRUP00000037515 ENSTRUP00000037515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]