SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037733 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037733
Domain Number 1 Region: 62-839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.9e-286
Family Motor proteins 4.89e-17
Further Details:      
 
Domain Number 2 Region: 1236-1354
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.22e-25
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number 3 Region: 840-964
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.14e-25
Family Myosin rod fragments 0.00000206
Further Details:      
 
Domain Number 4 Region: 963-1073
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.15e-23
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 5 Region: 1431-1553
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000000259
Family Myosin rod fragments 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037733
Domain Number - Region: 1806-1913
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000128
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number - Region: 1598-1833
Classification Level Classification E-value
Superfamily Tropomyosin 0.00017
Family Tropomyosin 0.00061
Further Details:      
 
Domain Number - Region: 1071-1183
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.0055
Further Details:      
 
Domain Number - Region: 1354-1430
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037733   Gene: ENSTRUG00000014763   Transcript: ENSTRUT00000037869
Sequence length 1939
Comment pep:known scaffold:FUGU4:scaffold_87:858208:868483:1 gene:ENSTRUG00000014763 transcript:ENSTRUT00000037869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSRDPEMECFGPAAIYLRKPEKERIEAQNTPFDAKTAYFVTEPKEMYLKGKLIKKEGGK
ATVETLCKKTITVKDDEIFPMNPPKFDKIEDMAMMTHLSEPTVLYNLKERYAAWMIYTYS
GLFCVTVNPYKWLPVYDSVVVGGYRGKKRIEAPPHIFSISDNAYQFMLQDRENQSILITG
ESGAGKTVNTKRVIQYFATIAVAGGKKEQQSSSKMQGSLEDQIIAANPLLEAYGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLATGHKPEL
IEALLITTNPYDFPMISHGEITVKSIDDIEEFIATDTAIDILGFTAEEKASMYKLTGAVM
HHGNMKFKQKQREEQAEPDGTEVADKIAYLMGLNSADLLKALCYPRVKVGNEFVTKGQTV
PQVNNSVMALGKSVYEKMFLWMVVRINEMLDTRQSRSFFIGVLDIAGFEIFDYNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDMTFKNKLYDQHLGKSAPFQKPKPAKGKAEAHFSLVHYAGTVDYNVTGWLDKN
KDPLNDSVVQLYQKSSVKLLAYLYAAHPGAEEGGGAKKGKKKGGSFQTVSALFRENLGKL
MTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDF
KQRYKVLNASVIPEGQFIDNKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGQLEEMRD
EKLAILITMTQALCRGYVMRKEFVKMMARREAIYSIQYNIRSFMNVKTWPWMKLYFKIKP
LLKSAEAEKEMAQMKEDFEKTKEELAKALAKKKELEEKMVSLLQEKNDLQLQIQSESETL
SDAEERCEGLIKAKIQLEAKAKETAERLEDEEEINAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLVEEMASQDEAIAKLSKEKKALQEAHQQTLDDLQAEEDKVN
TLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDE
KIKKKDFEISQFLSRIEDEQALSIQFQKKIKELQARIEELEEEIEAERAARAKVEKQRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQAD
TTAELGDQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAIAKSKTHLEKLCRTLEDQMSE
MKTKSDENVRQLNDIGLQRARLQTENGEISRQLEEKETLVSQLTRSKQAFIQQIEELKRH
IEEEVKAKNALAHAVQSSRHDCELLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEESIEAVNAKCASLEKTKQRLQGEVEDLMIDVDRANAL
AASLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTEMFKMKNSYEEALDHLETL
KRENKNLQQEISDLTEQIGETGKTIHELEKGKKTAESEKCELQTSLEEAEATLEHEESKI
LRIQLELTQVKSEIDRKIAEKDEEIEQIKRNSQRVIESMQSTLDAEIRSRNDALRIKKKM
EGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDEAIRGQEEMKEQVAMVERRN
NLMLAEIEELRAALEQTERSRKVAEQELVDASERVGLLHSQNTSLINTKKKLEADLIQIQ
GEVEDSIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLD
EAENLAMKGGKKQLQKLEARVRELEGEVEAEQKRGADAIKGVRKYERRVKELTYQTEEDK
KNLVRLQDLVDKLQLKMKSYKRQAEDAEEQANSHLTRYRKVQHELEEAQERADIAESQVN
KLRVKSREIVKVKTTESEE
Download sequence
Identical sequences H2ULB2
ENSTRUP00000037733 31033.ENSTRUP00000037733 ENSTRUP00000037733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]