SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037771 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037771
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-57
Family G proteins 0.00000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037771   Gene: ENSTRUG00000014783   Transcript: ENSTRUT00000037907
Sequence length 212
Comment pep:novel scaffold:FUGU4:scaffold_23:1757835:1760018:1 gene:ENSTRUG00000014783 transcript:ENSTRUT00000037907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQYDVLFRLLMLGDSGVGKTCMLRRFTENEFDSSHISTIGIDFKMKTLEIDGLKVRVQ
IWDTAGQERYQTITKQYYRRAQGIIFVYDVTNQPSFQHVAKWVSDVDQNAPDTVQRILVG
NKCDEELGRQVTREQGSKLAENYGMEFFETSASTNSCITESYTRVAQLVLQAHKRDVDSL
LGSLDDYLDKVALEDDRVLPHIIGDSQKNCAC
Download sequence
Identical sequences H2ULF0
31033.ENSTRUP00000037771 ENSTRUP00000037771 XP_011614971.1.43653 ENSTRUP00000037771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]