SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038486 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038486
Domain Number 1 Region: 29-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-20
Family Nucleotide and nucleoside kinases 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038486   Gene: ENSTRUG00000015065   Transcript: ENSTRUT00000038625
Sequence length 531
Comment pep:novel scaffold:FUGU4:scaffold_72:1151591:1153987:-1 gene:ENSTRUG00000015065 transcript:ENSTRUT00000038625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIYFFTSVGNRNTFMLNPLKYLRQPKPSPAPPIKIAVVGPPKSGKTTVAQMFAQKYGLAR
LSIGSVMRKVLNTQKCTHLVGQMQNYLTQGLVVPDELAIQCLEVVLLSSVCSTRGYVLDG
FPMTLKQAKLMGSRSITPMIIVELELDTVEVLKRGLADKMRPKKLHLMHNSAEILHIRCA
CYKQEVEHVRRYFRKEYQNWIQVSGLKSKWWIWDCILTEVSISMKYIRSYLERTRKGQAA
CINRLCITPKELQCHLGEFGLYCPVCLALHHHLFDCSEDEALTHAAEHRGHYYKMCGKNH
LERFLLTPDEFVTLGCPHTLPPPDQLPAKLTEIQVKNRFPQQAEMNGFCSVTFLEGKQRY
EALVQGKINYAAEYRGKIYFFETEQKRHKFMRTPETYLIPKLPVKVPPVCEPVSLTSLPV
LGYLEQGVSEAIIKAMTAVGCLKPKYPFINIQKSALIYVALYLKAFNHNSTTRNREQYRK
KLALFEEDCALVPYLGSIMKGDYKPPNERPIDFEFKLNRFSALRVSPKPNS
Download sequence
Identical sequences H2UNG5
ENSTRUP00000038486 31033.ENSTRUP00000038486 ENSTRUP00000038486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]