SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039254 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039254
Domain Number 1 Region: 50-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-21
Family Calponin-homology domain, CH-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039254   Gene: ENSTRUG00000015361   Transcript: ENSTRUT00000039395
Sequence length 1072
Comment pep:novel scaffold:FUGU4:scaffold_17:2023610:2039914:-1 gene:ENSTRUG00000015361 transcript:ENSTRUT00000039395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHETSSQRCTRSRGAEACMMASPAEGHDVPKTPPRAESERAEPPRHPEPACQEAQKWIEA
VTGKSFGDKDFRSGLENGILLCELLSAIKPGLVKKINRLPTPIAGLDNLSVFLRGCEELG
LKGAQLFDPGDLQDTSIRANLKDSDCTRKLKNVLNTVFWLGKAASSCTSYSGPALNLKEF
EGLLAQMKVESEGGEGPQKRGVRDSGYDCWDSERSESLSPPRHTRDNSLDSLDSFGSRSQ
HSPSPDVVNRGTGDGRGSDSEIDAQGKRPDVRKDDMSARRTVSNESRSTIPFNQFLPNRI
NASSYIPAPRRRPHTEEGEQRREGPTNVAPVSAMKPLNSRPKYTEKVDNERSVSMGDIIN
EDEMGHSPSLSQSRHEHMHEQYNNFVEEEEHWQGELTRWKNRRRSASQELIKKEEERKKM
EKRMKEEGSDINKRKSIKTYKEIVEDKERREIELCEAYRNAASPEEASMVLQRYALRFTI
SDATLDSLKLPRSTSGLKQDTNHMLQSSTAESPSLHQKQGNPEEKRSPTICTPTEITQMQ
PDATHPAHTLPSPSSATPRPVPLLAAKPYCQPRNSQPGHKPVKMDGLVRVNGEVMEDLSV
STPVSSSPEGPQETTDLPPAEKEDLATAQPATKEETGKRTPPPQTDDKMPPSRRENLTTF
SGSAISSLLGGRNCITTTTIVTELTQTRVEPHYPPLQGNGQVISCQMKLLFFPSFLNLIL
SGLLVSISRCSLSCPLTFPFLCPVCLNIETPMLNLAKRVNHWVWDPNEERKRLESWQQEQ
ERLLQEQYRSEQEKLKKEWEKAQLEVEEEERKHIEEERRILQETVTHLTPTGLAGQQLGQ
TTIVSSAPGTNENQTENAPLQENGHKMAPGNEDQHASKLHFFLGRKNRDIFRACSPGKCN
KSVLFFFILKDSASDAKPLKKQELWKTASLDRNPQLNQAQVVKRSSCDLKDGVYLFFGTT
DPNHTMPSQRNSSHPFHHRSLLPPAGDDANANKRCVSGKRLCSGCSQPLEKGAAMIIDTL
GLFFHMQCFKCGVCNGQLGDTTKGTDVRIRNGLLSCYECYIASRGRGQPTTL
Download sequence
Identical sequences H2UQN1
ENSTRUP00000039254 31033.ENSTRUP00000039254 ENSTRUP00000039254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]