SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039399 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039399
Domain Number 1 Region: 1028-1132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-32
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039399   Gene: ENSTRUG00000015410   Transcript: ENSTRUT00000039540
Sequence length 1134
Comment pep:known scaffold:FUGU4:scaffold_7:2206712:2213444:-1 gene:ENSTRUG00000015410 transcript:ENSTRUT00000039540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSVRPAVSRASGERGKPEVAGTTGTGKPVSKSSTAAPLSKVKSSDDLLAAMAGGNPTS
SNAVAKTKRTASVGTTASTLDKPKTTSGTTSKRLTSSVTKETNLTRDRLRTSRASANKKQ
SAAGTVVGDAASGKRSRSQVLVESESRMSKSKSDGQISDKVALEAKVKDLLGLAKSKDVE
ILHLRSELRDMRVQLGLGGKELQEGPEEEEEEEEEEKPHVSAITAADVESTLILLQEQNQ
AIREELNLLKSENRMLKDRLNALGFSLEQRLDGSDKLFSYASLSPDLAAGSGQSDGGGTG
TLTSSVEGSAPGSLEDLLAGHQHGGSADNLDSESSEVYQAVTSSDDALDAPSGASSSSES
ECAPSRERSRRGSSGNASEVSVACLTERIHQMEENQHSTAEELQATLQELADLQQITQEL
NGENERLGEEKVILMDSLCQQSDKLELYGRQIEYLRSLLDEHHVSYVLEEDIKSGRYMEL
EQRYADLAENARFEREQLLGVQQHLSNTLKMAEQDNAEAQEMIGALKERNHQMERIMESE
RQGRAAVEAALHEYKDAVSSEQAELSRCRAQLDQERQRVAELYSLHTAGDKNDICQLLEG
VRLGKEEAEAKAAKLQEGLEQAHSDLGHLQETFSKLDREYREFREQAQRQLSEQERALEK
QRMDLQEKETEIADMKETIFELEDEVEQHRALKLHDNLIITDLENSVKKLQDQKHDMERE
IKILHRRLREESMEWRQFQADLQTAVVIANDIKSEAQEEIGDLRRRLQEAQEKNEKLSKE
LEEVKSRKQDEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPSPTVKTLIKSFDSA
SQGTTGSPPPARTLAAICPPSNGASVTPTVSAAPLPRTPLSPSPMKTPPAAAVSPIQRHS
ISGSMSAAKPLSSLGDKRPTYTDITIPAEHLLRGSAASRPPSALQRVSNMDSTKTISAVS
RRSSEEMKRDMSASEGASSTSLMAMSAASAPLSLSSSSPTASVTPTTRSRLREERKDPLS
ALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQEL
TSQEKRRNFTLAFQAAESVGIKCTLDINDMVHTERPDWQSVMTYVTAIYKYFET
Download sequence
Identical sequences H2UR26
ENSTRUP00000039399 31033.ENSTRUP00000039399 ENSTRUP00000039399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]