SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039658 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039658
Domain Number 1 Region: 18-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-84
Family Calponin-homology domain, CH-domain 0.00000121
Further Details:      
 
Domain Number 2 Region: 6217-6373
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-29
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 5997-6155
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 4904-5063
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-25
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 5668-5827
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-25
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 6 Region: 5822-5938
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-25
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 267-382
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-24
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 5338-5496
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-22
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 4028-4189
Classification Level Classification E-value
Superfamily Spectrin repeat 4.24e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 10 Region: 6705-6784
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.18e-20
Family GAS2 domain 0.00051
Further Details:      
 
Domain Number 11 Region: 4362-4516
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-19
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 661-799
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-19
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 13 Region: 4795-4918
Classification Level Classification E-value
Superfamily Spectrin repeat 4.18e-19
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 14 Region: 6379-6485
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-19
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 15 Region: 3589-3728
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-18
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 16 Region: 1241-1365,1392-1416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.97e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 5249-5374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000236
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 18 Region: 6616-6696
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000381
Family Polcalcin 0.044
Further Details:      
 
Domain Number 19 Region: 3344-3453
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000122
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 20 Region: 4264-4408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000707
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 21 Region: 4575-4733
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000497
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 22 Region: 3785-3904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000802
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 23 Region: 5061-5175
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000301
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 24 Region: 3471-3582
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000314
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 25 Region: 5495-5607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000777
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 26 Region: 3938-4042
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000151
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 27 Region: 5168-5277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000528
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 28 Region: 6493-6558
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000259
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 29 Region: 1666-1686,1740-1861
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000384
Family Plakin repeat 0.017
Further Details:      
 
Domain Number 30 Region: 4159-4261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000484
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000039658
Domain Number - Region: 3096-3204
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00017
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number - Region: 2847-2958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00157
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 605-653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0018
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number - Region: 1059-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0461
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039658   Gene: ENSTRUG00000015507   Transcript: ENSTRUT00000039799
Sequence length 6993
Comment pep:novel scaffold:FUGU4:scaffold_24:1164345:1222656:-1 gene:ENSTRUG00000015507 transcript:ENSTRUT00000039799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQYAPQASALTDEQEYLQAYEDVLEKYKDERDRVQKKTFTKWINQHLMKVRKHINDLYE
DLRDGHNLISLLEVLSGDTLPRERGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDG
NPKLTLGLIWTIILHFQISEIHVTGESEDMTAKERLLLWSKQLSDGYVGVRCENFTTSWR
DGRLFNAIIHKYRPDMVDMTRVSAQTNRSNLEHAFCAAEQLGVPRLLDPEDVDVQSPDEK
SVITYVSTLYDAFPKVPDGADGISPNDIDIKWVEYQNMIKYLSQWIKHNVAIMSDRSFPN
NPVELKALYSQYLQFKEHDIPLKENEKTKIQNLYKMLEIWIEFGRIQLPPGHHPNDIEKE
WGKLIVAMLERERSLRPEVERLETLQQIANRVQRDCVNGEDKLALAQTALQSDAKRLESG
IQFINEAETAGYLLECENILRQQVVDIQVLLDGKFPFADQLVQRVSKLRDDLLALRADCS
SLYSKGRTLTTEQTKMMISGITQSLNSTFPQNTSLTPVLTPALTPGGLGAPGSAFTSSLT
SCLTPSLSPSMNSVLQPPSVQTFMDSSGDPSGLRHLKHIQSSKPLRKSSVADPSLTDEEV
NMRFIKGLQTWVEEMQSQLGRSEWGNDLPSVEAHMDSHSGIHRDIEEFQMSLKEAKLSEI
QMNPPLKLTYSEKLNKLEKEYEILLGFSRERQSHLESLHDFLSQATQELIWLNEKEEEEV
AFDWSDRNSSISKKREYHTDLMRELDEKESVFKSVQDKGEHLIRKNHPARATIEAYKAAM
QTQWSWILQLCSCVEKHLKENAAYFEFFSEAKEAIDFLKNLEGSIERKYSCDQTSSLHRL
EDLIQESMDEKEQLLQYCSTVAGLVGRAKNIVQLRPRNPESPIGSSIPVKAICDYRQIEI
TIHKEEECELTSNSHRAKWKVISPAGNEAMVPSVCFTVPPPNKEAADAAAKTEQLYQNVL
ALWHHSHINMKSVVSWHYLMADVRAIRNWNVASIKTMLPGEHQQVLGNLQSHFDEFLQDS
KESEVFSVTERAELEKDVLACKEYYQELLRSAEREEHEESVYNRYISELRNFRMLLEAHE
EHLIRQLRTPLERDDLDQSLQRISEHEKKTAELNKLKEDLDVLKEKCELFLREATASPSV
SKLSSELTVLLQSMSQVYSMSSIYMDKLKTVSLVVKHSQSAEALVKTFEFKLYEEDAMNP
DIKSIESAISTLKQRQAEIDEKQEVFHMMEDELQKARLISERMFKTHNERDFDLDWHKER
ADQLSERWQNIHSQIDSRLRDLDGIGKSLQNYRDSYCSLDEWVRETEAEQLKAQENKPED
SKSLAVLLNKQKVLVAEIEQKQSQIEACQKHSEQYSAAIKDYELQLMTFRAMVDSQHKSP
LKKRRMQNSSDTIQQEFMDLRTRYTALVTLITQYVKFASETLKRAEDEERSADEEKREHG
DKVSKLLHWVSNVQQSSNNNENALKDSNANTDVSVEEMVTKKEQVAEALRATQMILSKHS
EKMTEDEREKAQEQMKALNQAYSELSQHCSDQNNSSEEVGHLVVSSPVVSLFCLLPHAGA
EQETFKQLKDFKSTYSGFAFGSGAALPETRPMTSDPFQADVFLDWCGPLEQDAMFESFLN
HSPTLNEPKKPGSYVSSSGLSTPARERKDAIIKVIEVKTDSNGVNVSYTGETVSLESAFQ
LGLIAASDYANVLERQKTPRDASEDVSPFEPVQEVEPCDVNSFISKCLSRNKSPISPRDV
HALKLSSPQLDVGDLIKPHDMDILNVDAAVQCDLRSSSSTLVVLASQQQYLGLVLPPSEE
IRMFSESFEDNKLSAASEFTSSLFSNKEKIAAFYIPHFSEVVDFDVATQKGLIDMHTAEV
LRTIEIPDEVPDVDRLNEKFSSWLMYRKLTVDGCFHAAHCLKVDSVPSPAEAEQLFISYL
MINSYIDPKTGKRVVILDNELSKMVKIFLEEPVSSEDGNKCTTSLELNVLDQADLNLKLH
RKEEMDTGIEDNKHTCEPPYFVSSLNENVSFRVEAHTGDQAVNHHPVTDVTEDNDTNVDE
SDPHISEKLVCLKNPGWTKSGEFVRMIYGNGSETDDADGDSGQSSHLTPRHNNAESICSE
SDVTDPFEAEFLCPDYLSDDEQQFVIEILEAQVEEEEDILEIPSARHAGVNAALSENLVD
PEAFVKLLNSHSDDTGSTEGDEWDSMSDFKETASGGYNSSYRAYFLAEKQTISRSGCSIS
ISESYHTGVTENEFVASDLETSLYSEDECPPCTAGSNNLDFTDANGNEKQPMVKKGSEAA
EDTEFEREIADKEVDCERTGNVEEMSRDLDRCFPAVDGRSSQMFSCSPWSQVTADHHTSK
SSFPTGRSDSQDMSNSQLTGAPDEGEITQTSEERGNSVSLTQYPTFTPPPDSDSPLFVEK
VLIAESDSEVETQECSESESDNLTPSHVLMYENKATESETSALEPHLSSEPGPSRHYSST
RVEDIMSHSRKEDGTRMTSPQPAEAQAERVFCVEQEADQGFPQLAISSDEVILPDHFESI
TDDESECEDSQTAIRTSPEAAPVDQHVSASQFGSVDDEPSPGFSHERQQISGDREETSDG
VVAPGEMSSEQAEPAANVESGSETPADNNRTAEDDSKHVPFSQSDLPNVPSGCCATSVPL
SGAWGVGKAPSEEREVKDFQSAEDVGSIHSILANTSQLLEKDVHKNDTPHALLESRHPDL
LVDLLKRNAHNLESKEAGETRQEVKVNQKAEEFPSIQQQLLQVLQTVTSSQDLSMLQEVM
QSLNVALGSNTQEDPRHLLDSIKEESSEGEDEGSAEDESPQSSASSNGCKVKQTEKKVQY
NLIFFKQSNICFNFVNPPQQLFSIQDYLECVGRLQDHCDTLDDVRKDFLIKTNLGKTLEE
LQIQVEECQALESQLSRLTCGVNEDMEKAKELLNSSDEAIPVQICRDLASARLGLETNFS
AVSQLCAEKGSTLMQAMETGREQLDSSYQNHLAHLHDIREVIQATSVLNDVDTATCDVDA
LKLIIQRNKDSEKNLLSEAKVKLEDTTLDVQCFLSENTQFLSPAQSSRLLKSLSSAQRAF
RDQAEMLASQRSTWDILLDTRERDNQEKVLLAKQREFTEKLEEVCSNLTQTENHLIGHQQ
QAENAKSVSDLQQYQQEHQALQKDVLTNASALNEVITSTKRFLEENRSKLTPDQITVLEN
KLEEAKSKAKLIDQRAEESRKDLEKVVTTAIKQESEKAAAVERLEESKNKIEVLLDWISN
IGNENSSGLDQTDRISKENGNLPAVTSAEGLIRMEDDDANGNALQTSGKDFGRETSGKQD
ASLDLDKQYDRVKAHHQEILSQQQDLIMATQSAQAVLDKQANMLTPEEKDKLQKSIQELK
GRYDASLTQAEQQMKQVQCIQEELKKFRSDVEEFDGWLDQAERDMGDLGAPGDSLDDLSA
KVLRQKSFSEDVISHKGDLRFITMSGQKVLDVATACGLVDPVEKNAQLHVDTSKTCAAVK
EQLDSAASRYKMLHSQCNQLGNNLKDVVDKYKKYEDSSTGLLKWLSSSEEEARKQQSEAI
AADPKTLQTQLEETKMLQVQMTGRQTAIDTLRKSADSLIKSDGDLLSNPDEIQESVDDIV
ERYDNLSKSVSDRNEKLQITLTRSMSVQDGLDEMMRWMEAVETSVEEKGPLPLDSASIGD
ILSKEAALEQDIASRQSSIAAMKAKVKKFVETADPAAAALLQSQMDTLCQHFSDACDNHK
RKVSKLEQLKEKVETFEKLADKVQQFVVRRSQDLHETDGPGKTFTELSQLMQNTKAEMAE
HVRDLETLQTLSKELSEISPDGNEAQIQSKMENLSNAFSTFKDTVKEREEEVSTCRDQLE
EFRSTAGALSKWLEETNEKVPAAQPSSSKTLEKDLQIVSGLLDEWNSKGPAVQDLNTKGS
SLCHLITSLTSPAKIKANKSASALTNGAGAGSHFYLTNKELTVIQQNMSFVNEGYESLGE
KLKSRAAELKSSVHNISEAKEETDTIITWLKDMKKTAASWNNSDGKDSVKTQLEQQKVFE
EDMKQKEEQLQKLREKLLNLIKTYPNSPEAAKWKQMLAEIDAAWADISGSVEERKQHLEE
SNKNLDIFQTTEVQLGQWLSEKELMMSVLGPLSIDPNMLKMQKQQVQILQNEFKSRKPQY
EQLVEAASAILNSGSQDPSSGKLVKEQLTALTQKWQGLTGQLDQRDGLIDQAVVKTGDFQ
ALLCSLGQTTAQLEKQLTHHQSHSTQPDAVKKQLEDVQNISVQLREERKKLKEAEAINAE
LTTMVTEDYLKADLARQLESISKPFKQLDEKAAKRIEQLNSTFASSQQFHQTSKDFQSWL
SEKLQDQLKPQAISAKADPLQQSLEEHSKLQELLSEHEDAYNTIMREGEMLLHDAEGAEK
VALQGQLTSLSSNWEEVKKSAAEQADKLKTALQKSLKYQEHAEKLTTWIQECEACENRVK
LTVDPVGVEGSVSQVKALQKDVDKHRGMLEQLNTAVDGLLEVANADVEAVKEEKASIGKR
VEGIAEALQSKREALEKIAHKVKDFNDVYKEAKDQLEGAGKQVDAYESQGLQAHSNKTLT
NMKAQHKSLEGVQNQVEHLKNLAKDLVVDVPDAEGVTDLLLQADGLEKNYSTLNRKLDET
CQVLEGKLQGIGQFQNNIREMFTCFTDLDDELDSMAPVALQLAPLKEQQDSLDSFMAKLR
ELMANTANAGDSCKKMLETETSPDLLGLKRDLDALSKQCGKLMDRAKGRELQVQSTLTRL
EALYHQIHQVDEKLCSAVAKEASQEAVGMETDVINQQLEAFKAFQKEDIDPLQLQLQDIN
SLGQGLIQTAANGTRTKKLEDDLEEVNRKWNTLNKKIAERSAQLHEALLHCGRFQDALES
LLSWLTDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKPTVELIKKEGGKVAELA
ESVDKEKVAKEIECLGQRWDALLKKAENRHKQLESILVVTQQFHETLEPLNEWLGATEKH
LINCEPIGTETSRLEDQISQHKALEEEIMNHSKDLFQAVSLGQMLRTVSSVDDKEFVQSK
LDAAQAGYIELQERCRRKAEMLQQALANAQLFGEDEVALMNWLSEVHARLNEVSVEECKI
DVLENQLGEQRALQSDIELRKKNVEQAICNGVELLKQTTGDEVMVIQGKLEGIKTKYSEI
NSMSGNVLKKLEQVLNLSTKLQQTHEDLSSWLEGAESETRAFEPVGEQLVHAQSRQRALL
KEAKEQKPLVDKLNELSSSLLDLIPWHTREGLDRMVTEDNERYRAFCDAAAQQVEQMDAD
LLKSQQFEQAADAELSWLTDAERKLLSMGEIRLESDQTTAQLQAQKCFAMDIMRHKDALD
DIVKTGKSIMNSKTPEEKEMLKAKTQSLLEEYAVVSQLNSERCLQLERAHSLASQFWETY
EEMWPWLQETLSTFAQLPPPAIEYDTLRQQQEELRQMRELIAEHKPHIDKMNKTGPQLLE
LSPVEGIPVREKYTVSDQLYTKLKADVKQRAATLDEAISKSTQFHDKIDPMLESLDRIAE
RLRQPPSISVEVDKIREQIAENKAVSVDLEKLQPLYETLKQRGEEMIARSEGADKDISAK
AVQDKLDQMVFLWSDIQALQEEREAKLLDVMDLADKFWCDHCALIVTIKDSQDLLRKLEE
PGVDPSVVKQQQEFVEGFKEEIDVLQEELDVVQNQGAELLTACGEPDKPVIKKSIDEVNS
AWENLNKSWKERAERLEEAMQAAVQFQDGLQGMFDWVDILESKLDSMSPVGTDLETVKQQ
IVELKEFKKEAYQLQIEMERLNHQAGLLLKKVAEEADRCAIQEPMSELKMLWDSLDEKII
GRQHKLERGLLALGQFQHALDELLAWMSHTEELLTEQRKAGGDPKAIEIELAKHHVLQND
VLAHEATVETVNKAGSDLVESSAGEEASSLQSKLENLNQRWKAILEKTAQRKHQLKAALL
QAQGFHGEIEDMQQWLKDTERQLLASKAVGGLPDTAREQLNAHLELCSAFEAKEVLYQEL
LNKGQQLLAVTPAGPDSNTEQDLANLKDKWEAVQGKVTERKVKLEEALELATDFHNSLQD
FINWLTQAEQTLNTVSPASLILETIMFQIDEHKMFVTEVNSHRDHIIELDQTGTHLKYFS
QKQDVVLIKNLLLSVQGRWEKLVQRSVERGRQLDDARKRAKQFHENWTKLMEWLDESEKS
LDTDVEIANEPDKIKTQLLQHKEFQKALGSKHSVYDTTARTGRALKDKTTLKDDNQKLDD
MLSELRDRWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGD
IDLVLNLIDNHKVFQKELGKRTVSVQALKRSARELIESSHDDSSWVKVQMQELSTRWETV
CNLSVSKQARLEQALCQNKAEEFHSTVHILLEWLAEAEQSLRFHGSLPDDEEAVQALIGQ
HKEFMKNLEEKRAALNKATSMGEAILTICHPDSITTVKHWNTIIKARFEEVQAWARQHQQ
RLATALTELLTTQELLENLLTWLHWAETNLSNKDKEPLPQEIEEVKNLIAEHQAFMEEMT
RKQPDVDKITKTHKRKAAVETQNQSQIPVFGKGRAGRKRSPTQTMYASATQAPIETKNPQ
VNLLLKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIEGILSSKF
PTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKC
PKRFQVEQIGANKYRFYLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR
VHHHGSKMLRSESNSSITQSPIAKGRTNVELREKFILPEGTTQVMASFRYRGRRSRPSSR
GASPNRSTSSQSCPVPAHTATVAGVKVTPVQGSKLRLPGYLSGKGFQSGEEGTLISAAVL
KARNQTLGETRRNSSRPGSKAGSRGSSRRGSDASDFDISDIQSVCSDASETVGESARGTP
RSASRQQRGRPSKIPTPQRRTTPTSKLAKGAKR
Download sequence
Identical sequences H2URT5
ENSTRUP00000039658 ENSTRUP00000039658 31033.ENSTRUP00000039658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]