SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040288 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040288
Domain Number 1 Region: 134-446
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.41e-119
Family Transglutaminase core 0.00000000369
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily E set domains 2.73e-33
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 586-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-25
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 4 Region: 475-584
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-24
Family Transglutaminase, two C-terminal domains 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040288   Gene: ENSTRUG00000015768   Transcript: ENSTRUT00000040430
Sequence length 684
Comment pep:novel scaffold:FUGU4:scaffold_20:2031867:2037305:-1 gene:ENSTRUG00000015768 transcript:ENSTRUT00000040430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCDLNIKSNNSNHHTDRYGDQRLVVRRGQPFSVLLHLKPDFKLSETSFIVETGPLPRE
ESDTKACFGLGDSTVDTEWSASATADPSGNTVSVSISPPPTAPIGLYSLTLEQEGQKVKL
GEFTLLFNAWCRGDAVYMRSETKRKEYVLAQHGLVYRGTHKRIKGTPWNYGQFDPDILDI
CLMILDSNPKFVSDADQDCSARRNPIYVTRVLSAMINSNDDRGVLVGEWHDYSDGVPPGR
WIGSADILRQWAESGPVRYGQCWVFAAVACTVSRALGIPCRVVSNFGSAHDSDANLIIEN
LYDENGENISQSDSIWNFHVWVDSWMTRPDLGSEFDGWQTSDPTPQETSEGVFCCGPAPV
RAIKEGELTKKYDAPFIFAEVNADVVDLVRLSDGQIVKFGGSTKSVGRFISTKAVGSEER
HDITHQYKYPEGSPEERQVYEKAQHRNKLQQRGEEPGLHLKVSATTEARVNDGAGNIKLA
HDMIVGSDFEVFAVLTNNCMEARTCSFMFFAKTVSYNGKLGESCGFASQKVEVAPGEDKR
LSLLVEYDQYGPKITSDRLIQLSAITIDKNAMDFHKAEKTVVLDEPDIEIQLSGEAKVSQ
LLTAELTLLNPLPELLQDCSFTIEGVGLTEGKPLTHRIEDVGPRQEAKASLQFSPSRAGA
TVLLVNFDSDKLNNIKSCINVDVR
Download sequence
Identical sequences H2UTL4
ENSTRUP00000040288 31033.ENSTRUP00000040288 ENSTRUP00000040288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]