SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040427 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040427
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-32
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000040427
Domain Number - Region: 1725-1753
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0745
Family Mitotic arrest deficient-like 1, Mad1 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040427   Gene: ENSTRUG00000015822   Transcript: ENSTRUT00000040569
Sequence length 2284
Comment pep:novel scaffold:FUGU4:scaffold_1:1343900:1394888:1 gene:ENSTRUG00000015822 transcript:ENSTRUT00000040569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLAKSGHKRLIKDLQTDVTDGVLLAEIIQVVANEKIDDINGCPKSRSQMIE
NIDACLTFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRFKQQQQQAQRQNSQPYLPQ
SSHPPLSHQSSSPAQLGHAPHGTSATAAQDGSQSKLLKFSLGQKKTSRLPGPSARVSTAG
SDVPSRGSISAAGNRRSQGFSDKTKTSSHSSRVSADKENGASISAATSGLISPPSSSSSS
SSTTAIPQPNSNGKPWRSKSMSSKHAASSAPSSTMLSVKQEKEASGKAAVAGEAPKAATQ
KSMLEKLKLFNSKGGSKSSSSNGIGAQTDHAGLAKQPGAGQVERAETGSNTDPLETASSP
KIALRGIAQRTFSRALTAKKGSVKGSDKDKEKGKEKVKGEEPKEEVAPAALDTDSSTKRT
SKITSFIPKGGKVTKKDTSTPAHSGIPKPGGKAQGVAAKASSAKETGERPRSMRLVGGLS
THRGPLDRDRDSRHSSSTSSLASTEGKSSAAPVAGGGTTQSTASNTISVQLPQNQQHHSH
PNMATVAPFMYRSQIDGEGTPNEETGTGGLGGDVSLTKNSQLSTEDLSGEDPETRRLRTV
KNIADLRQNLEETMSSLRGTQVTHSTLETTFDGTVTTDISSTGGTVTNSGGSSRSILSLT
SSRPSLSSWRLGQSSPRLQAGDAPSMANSYGGRVAGSQGGRYLYPGHLRRQLAARGGGLC
SLDLGDRTGEDIDMEGMEVTGYMSDGDVLSKNITRTDDVSSGYMTDGGLGLYTRRLNRLP
DTMASVRETVHRNASSGQGDGDSWDDSSSVSSGISDNIDTDDINTSSSISSYANTPAAQR
KGLSTQPVTDAEKHSASTAGHQAWSGDEVKRADSGSDNGVRMESASSWTRRTPSDVSEES
DKGSSGRKITSVSHTGSWRRGMTAQVGITSPRTKSTSSTGSTGCKTDDIKVSEKGRRSPR
ANGLHRSPSDAGRSSGDEAKKQTHMLTSRTPTSTFGFKKPCPGMVAMVTASGATITSGSA
TLGKLPKSGGRSLTVGLKTGGLDGGSTLGHHDDSFLPMSARSTLQYRSLPRPSRSGAAAR
NGNRSSTSSIEAAVLSVTSQAKNPLSVSKVNGSGLLANQTDREKGVTDIDNLRGGGAATV
PLPGRQQVSSPTLRRLFGGKTSKQAPVTTAENMKNSTVISNPHAALNHVTTVLESPDGGV
GGVDSETNSPLFGGRVHVSGMGTLGSEQASSPGSVYSSTGPSNSLTWGTTFSSSSAQSRE
STLGGHSGAGSMGYPSVSSMHTSSESIDMSLGSAGHGTHKEENLSALGRTSSVKTGASES
GPHCGRNTLPKKGLRYGPSPQLRGHEESRDWLRSHSTSGLQDSANNSPFSPSLTSPSGTR
FNFGQLASSPTSTGQMNLTGLRNNSLSNQDVPFDPCSDSRLRNSCMSLDEKTRTMSRSGS
FRDGFEEVHGSSLSLVSSTSSIYSTNEEKSQSEQIRKLRRELDASQEKVSALTTQLSANA
HLVAAFEQSLGNMTIRLKSLTLTAEQKDSELNDLRKTIELLKKQNAVAQAAINGVINTPE
LVLKPDLRIRRQHSSDSVSSINSATSHSSVGSNMDADAKNKKKNKKNWASFTGDKLRSSF
KQAFSKKKSPKSASSHSDIEEMTDSSLPASPKLPHNGTGASGQMLRNTHSMCVNLKTARR
CLDRLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEK
LKAENDRLKVENQGSRTGSQVSISSSPPPHAHSQVPGTGPGLPQHSLNLTTSESTSLGSD
MLLDDTGGEGGMRKEGRHVKMVVSLDEDSKWTEEGRPRHFLIGCIGVSGKTKWDVLDGVV
RRLFKEYITHVDPMTQLGLSSDSVEGYKIGEIHRPSSTSAAHMPELLPCGYLVGDSNTIN
IQLKGVSSDNVDSLAFDTLIPKPMLLRYVSLLKEHRRVILSGPSGTARPTCQSVISTLAL
TPHAVVTFNVDHKSGKELRQYLSGLAEQCSGVPGAESPLVVILDNLHHVSSLGEIFNGIF
NCSYQHCPYIIGTMSQATSSAPNLQLHHNFRWVLCANHMEPVKGFLGRYLRRKLIEMEIS
SRTRSLELVKIIDWIPRVWHHLNRFLETHSSSDVTIGPRLFLSCPMDVEGSRVWFTDLWN
YSIIPYMLEAVREGLQLYGRRAVWEDPAAWVIDTYPWSASPALTEWPPLLQLRPEDVGFD
GYSAPREGVRKELPQSDSDADPLMNMLMRLKEAATSSSPQSYDSDSNSNSHQDDILDSSL
ESTL
Download sequence
Identical sequences H2UU03
ENSTRUP00000040427 31033.ENSTRUP00000040427 ENSTRUP00000040427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]