SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040442 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040442
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.72e-34
Family Calponin-homology domain, CH-domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 188-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000396
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040442   Gene: ENSTRUG00000015829   Transcript: ENSTRUT00000040584
Sequence length 855
Comment pep:novel scaffold:FUGU4:scaffold_40:1443984:1451705:1 gene:ENSTRUG00000015829 transcript:ENSTRUT00000040584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVKALQQWCRVQVQGYRDVSITNMTTSFRDGLAFCALIHKHRPDLINFDSLKKENVYE
NNKLAFGVAEEELGIPALLDAEDMVALQIPDRLSILTYVSQYYNYFHGRSPIGGMGGIKR
PAEGPAEEPSGKKNQPMVSKVFPSSQPTRENSPPPSSNTSRPPPSPKYPRNAKQDVVVEK
SNQTGTLSNKCISCNKRVHLVERHLVDGKLYHRSCAKLETSRNNYIHLSRIQSDLKCVVD
LPTNTSVSKPTPPRDPSKTSIDISSRLGPTWQKDKASTPPSFSSTLSTPSPPPSRPVSAL
SSAAKSDDSVNNEKKATNTDTKKAGSGTGAVQHVTAGEAVTITVNIGKKDVSLNSAEDKS
KASGVGSGSGNGSESSKAKAAAFISRKLAEENNNNKPPWTNVALKKTDKPSQVETPKREK
EAVRGRVKLKVDPSLLADLQTPEESRPVPVPRRPRSRTPDPGPTNPSSILPNTSGSTPPS
VLLYYNLSVCVFISQPSVKTKLLEAPLTGFTSGNQLLLIQSVNIFNCLSAAEHESPADWR
SKLKPISKQTNTCCRGFGPLLPPHACEPQMVSTPGQVLGPSPSSPKLSANGPGKSQTSGP
AQPQGPSPSISITPPAPKVMLPLSRLVCLKWWNVMKDCQSFPKCTGNYPALAGKHCWILI
INLPAQTPPGVSFQTKKPDYIPKEDILKELQEIDDNLTKLEKEGVQLEMRLRRYGEDDSF
MDELMVEWFNLIRNKQVAMRRESELVYIGKTQELEEQQPSVEQELRRLMETPEHLKSSWH
DEREKELMKKLMEIVNDRNAIVEGLDDDRLREEEEDEQLNRMMKDFNVQNRLSGFCLSLS
DIKKEKPKKKSPMSK
Download sequence
Identical sequences H2UU18
31033.ENSTRUP00000040442 ENSTRUP00000040442 ENSTRUP00000040442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]