SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040496 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040496
Domain Number 1 Region: 7-288
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-82
Family Protein kinases, catalytic subunit 0.000000000779
Further Details:      
 
Domain Number 2 Region: 369-666
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.05e-76
Family Ankyrin repeat 0.0000172
Further Details:      
 
Domain Number 3 Region: 1293-1408
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-18
Family DEATH domain, DD 0.0022
Further Details:      
 
Domain Number 4 Region: 680-709,781-890
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000221
Family Atu3015-like 0.091
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000040496
Domain Number - Region: 692-748
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0875
Family Atu3015-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040496   Gene: ENSTRUG00000015844   Transcript: ENSTRUT00000040638
Sequence length 1444
Comment pep:novel scaffold:FUGU4:scaffold_4:2014975:2044455:-1 gene:ENSTRUG00000015844 transcript:ENSTRUT00000040638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIFNQENVEEFYDIGNELGSGQFAVVRRCRHRSTGVEYAAKFIKKRRSKSSRRGVSRED
IEREVSILKEIQHPNIITLHEVFENKAEVILILELVAGGELFDFLAEKESLSEEEATQFL
KQILDGVFYLHSKQIAHFDLKPENIMLLNRSVPHPRIKIIDFGLAHKIDFSNDFKNIFGT
PEFVAPEVVNYEPLGLEADMWSVGVITYILLSGASPFLGDNKQETLANVSAVDYTFDEEF
FSNTSILAKDFIARLLIKDPKKRMTIQDSLQHPWIKPKDTQQALSRKESAVNMEKFKKFA
ARRKWKQSVRLISLCNRLSRSFLSRSNISVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
THLLGSLNSYDVNQPNKHGTPPLLIAAGCGNIQIIEVLMRKGAEIQAGDKSGANAIYYAA
RHGHVETLKFLHEKKCPLDIQDKSGETALHVAARYGNVDVVSYLCSIRANPDLADREQET
PLHCAAWHGYSTVARALCQAGCHVNAKNREGESPLLTASARGFVDIVECLVEHRATLEAS
DKDGHTALHLAVRRCQVDVVRCLLRHHCHLDQQDRHGNTPLHIACKDGNLAIVMAICSAK
ANLDLPNKYGRTSLHLAASNGSLEVVRHLCLAGVNIDAVTNDGKTAEELASVDHHDHIVS
LLVRLKKDNHKLSYIQQLRPTQTIQPRIKLKLFGHSGAGKSTLLESLKCGILRSFFRRRR
TRMTNTARHPNSPINSKPPVSVSISNLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPVHS
ALSTADEQATKAIDIQHANIHSVGDFSVWEFSGNPVYHCSYDYFAANDSTAIHLVLFSLE
EPYETQLSHVTYWLNLLKALTLPQDNIAFGGRIQQPLVVVLVATHADLADIPRAFSGEFT
YDKEKVLLKEVRNRFGVDLQISEKLFVMDAGASNSKDVKLLRNHLQELRSSIISKCSPMT
QLTERLLTTLPSWRKLSGPNQLTSWQQFVSDVQEHINPLVSQDHLRTLTMQLHSMGEINI
MQSETVQDVVLLEPRWLCSGILGKLLSVEAPKAIHHYRGRYRLEEVQALVPESDVEELLQ
ILDAMDICARDASNPFMVDVPALIKTSGLHRSWTEEDEEDEVLIYGGIRLVPAEHLTPFP
CGLFHKLQVNLCRWSHQQKSEEEGGEDFDGDIHLWTNGAKVSQAGVEAIILLVNHGQGVE
VQVRGHDSERAKCYTLLDTICSITENLLTSTLPGLLTAKYYLSPQQLREHHAPIMIYQPK
DFFRAQAQRESSLTNTMGGYRESFSSILSFGCAEVYQQGTLGTDIHISDVPLLARRKLCR
MLDPPDAMGKDWCLLAMNLGLTDLVAKHSSGTNGAAEPDSPQAAQQPSPTAALLQEWSSR
ADSTVGVLMAKLRELGRRDAADFLLKASPVFRVNAEAVGGAANGYPAICNGGTSYNSISS
VVSR
Download sequence
Identical sequences H2UU72
31033.ENSTRUP00000040496 ENSTRUP00000040496 ENSTRUP00000040496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]