SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040733 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040733
Domain Number 1 Region: 1331-1465
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.84e-57
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000164
Further Details:      
 
Domain Number 2 Region: 218-310
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000093
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040733   Gene: ENSTRUG00000015934   Transcript: ENSTRUT00000040875
Sequence length 1475
Comment pep:novel scaffold:FUGU4:scaffold_40:1536720:1547120:-1 gene:ENSTRUG00000015934 transcript:ENSTRUT00000040875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEIKPLDQYDFSRAKICASVRWLLSKSYGSAENVPVEMREPLYKDQYDQEHLKPSINKLL
VSPEIYCRAHVLLAQGVAVPGLSGRRRALLQLLEKKGLAPKVQDADVTQEDLRCVPIRMK
AHLAMIDALMTLAAKEIVDQVKMAAEAEQIGAGAPWENALLFWVNRLNQKLRELTEEEEE
PPRPQTCSDVQPAQDAIRYRKDKVQSKLTPTFPLIHGVKDLSNGCAIASVLHYYCPVLLP
LEDVCLKDTMSVADSVYNLQLIREFCESSLQSCCPLAVEDLLYAPPPLHLNIMSFISELL
HWFEVKKPDFVQPVQATDLTVLSRCRVLTSFSTSQMSQGYSTVQVPSTGVGTGRTVHQTV
AFINGSPSFILKQPFMPITSPVSPGIKPFPMPSASSPHRLSVVPENKCWTKKQIRYLYFI
AECSSMVNVQLCSYFLNFLLLASVVSAFPSSFCRSPSIHPCFHPPPPLCSRPLSAVTFSI
PFGLDSDVDIVMGNPIDSVFRSASTDTGIPAMTTPVSSGGANHVPYSPPEDISHLVSSSV
PLQRSSWGPYAHTTPLGELPTIEEALKVAHGPGSKERRKGNAAGKGGRPEARLRPEGAPA
GFFLHSPEEENPQLSSSAPCRSGVLHRPVGGEGVDGKRQGRGERRERSGCTPDMSRDDDS
VLRDGSVDSSEASDDGPRNAPGNMRPSKGHHGNQSAGNSPRMTSFAERRDNRRRHPAASG
EEAASAPTPTTPGTPHTPSTPAGAPGRQDSPGPRGPEPGSEAWELGVRLEEKRKSIEAQK
RRIEAIFAKHRQRLGKTAFLQLKRQQGEGGGGGGAEDNLTLEERLTRMEDQLKQEEEKEE
KDKEKDGAQEKDKSALNPPRLEKQVTFSIESKKEAETKKAAEKGGEVMLVEYNEVVQKLS
EALQSLQKDMQKLTEQQQQLMSNQRPRNTPKNAPRTSAKKQPGTPPQTPTRTPPRTPTKT
PTRNTTHPRPSELKFPPLNRMLTPTHNVDTLPHLRRVSPSKCQHPRQDRPRAADGSSSGA
PSECSFESETFSISAAYSRGGDAGRGVSAGTHRYEVNDEQTDEGREFSSDSMSDHTESAV
EPARRPAAAALDPTEQLDLAMEAINTPEQPAEPKEEQMGLTETAGPSAEQNESGAKGRIH
FFFTEDVQNEEEMAQRKALLLEKQQRRSEELKKRKQWHERERENSTPPVGTTSPSATPPA
TPARRGGFTRAEYARRQQLRIMDDLDKMLQQKSASQVRNPAKKARSRPRSMTREETRLSL
SPAKTTTGSKLAKVHSHSSVNLAATEEPRNKSDGPSNTSVHNRPGIIINYEPIWQIDKEW
DTGSNGTSPAPEYTGPKLFKEPSFKSNKFIIHNALSRCCLAGKVNETQKNKIVEEMEKSD
ANHFLILFRDASCQFRGVYTMNSDSQELVRLAGVGPRTIGSTQVESMFKYSSDRKQFSTI
PSKTMGMSVDAFTIPSHLWQKPKQNKMPNFSFRRK
Download sequence
Identical sequences H2UUV8
31033.ENSTRUP00000040733 ENSTRUP00000040733 ENSTRUP00000040733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]