SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041081 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041081
Domain Number 1 Region: 52-523
Classification Level Classification E-value
Superfamily Sema domain 8.5e-127
Family Sema domain 0.0000626
Further Details:      
 
Domain Number 2 Region: 1375-1501,1697-1886
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 974-1056
Classification Level Classification E-value
Superfamily E set domains 9.7e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 4 Region: 1056-1160
Classification Level Classification E-value
Superfamily E set domains 6.02e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 871-967
Classification Level Classification E-value
Superfamily E set domains 0.000000000000013
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 6 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000536
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000041081
Domain Number - Region: 823-858
Classification Level Classification E-value
Superfamily Plexin repeat 0.00017
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 1176-1231
Classification Level Classification E-value
Superfamily E set domains 0.000182
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041081   Gene: ENSTRUG00000016066   Transcript: ENSTRUT00000041224
Sequence length 1916
Comment pep:novel scaffold:FUGU4:scaffold_8:1397932:1524603:1 gene:ENSTRUG00000016066 transcript:ENSTRUT00000041224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLTRTWTCFFVCCFLSSLVLPVTSETVLQAAQAHSSQVITASLQEEEYASFRAENSEW
KFNHLAVDYRNGNVYLGAVNRIYKLSPNLEVQVSHETGPDEDNRECYPPRIVQPCSEPLT
LTNNVNKMLLMDYRENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGANESGPV
FGVIVSYGNASPDMLFVATAVDGKPEYFPTISSRKLARNSEEDGMFAYVFHDEFVASMIK
IPSDTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGSGPTTGSSSTGREQVYTSKIVRLC
KSDPAFNSYVEVPIGCISGNVEYRLLEAAYLSKAGSILARSLDVAPDDDVLFAVFSKGQK
RHLHQSMEDSALCVFSLREINEKIKERLQSCYKGEGTLDLAWLKVKDIPCSSALLTIDDD
FCGLDMNAPLGVSEMVRGKPLYTDAFDKMTSVIAYVYKNHSLVFVGTKSGQLKKIRVDGS
SLALQYETVQAVDNGPILRDMAFSSDFHYLYVMSETQLSRVPVEACGQYSTCSECLGSGD
PHCGWCVLHNTCTRKEKCERSLEPRRFASDIRQCVRLSVHPNNISVSQFSVTLVLEAHNV
PELSAGVNCTFEDLAEMKGLVEGNRIRCSSPAEKEMPRIIVDKGDHQIVQLYLKSKETGL
VFANTSFVFYNCSVHKSCLSCVSSPYQCHWCKYRHDCTHDPRTCSFQEGRVKKPEGCPQL
LPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPALRFNSSSVQCQN
TSYFYDGMDMSSLPVELTVIWNGDFTIDNPTHNKVHLYKCDAQRGSCGLCLKADPLFGCV
WCKGENRCTLKQHCPYPENQWLEHNGINSKCTHPRITKITPLRGPREGGTLVTIRGENLG
LDFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEKSQYTGNVQVCVGVGECRPEFM
AKSSKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSVMFKDQPCTYLRRGGQ
WLTCRTHASLHGYGNVSVSVSIDRAHLQKDLRFEYVEDPTITKIEPEWSIYSGHTPVTVT
GTNLDIIQTPLIRAKYNNHETLNLCQVLSPTSMLCQAPELPISLARQQEVLEKPDEFGFK
LDDVQSLMALNNSNFIYYPNPEFELLSVSGVLELKPGSPIILKGRNFLPPISSGNGKLNY
TVLIGEKPCMLTVSETQLLCESPNLTGRHKVLHHKARVGGIEFSPGVVDIMSDSPLSSTA
IISIAAAGAMLILVIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQT
DIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKLFGQL
INNKVYLLCFIRTLEAQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDRNLE
SKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSIT
GEARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTISQVKEKILDAIYK
NVPHSHRLKASDMDLEWRQGRGQRMILQDEDITTKIEADWKRLNMLSHYQVPDNAVMALV
PKQVTAYNSVNNSTVSRTSASKYENMIKYSGSPDSLRSRTPMITPDLESGVKVWHLVKNH
EHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFD
FLDEQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIYKSSITDACLSVVAQTF
MDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDINKMPAISDQDMNAYLAEQSR
MHMNEFNSMSSLSEIYSYVGKYTEEIVCMLEHDDGARKQRLAIKLEQVVALMTLES
Download sequence
Identical sequences H2UVV3
31033.ENSTRUP00000041081 ENSTRUP00000041081 ENSTRUP00000041081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]