SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041188 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041188
Domain Number 1 Region: 115-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.34e-67
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 346-480
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.8e-24
Family Ankyrin repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 604-641
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000288
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041188   Gene: ENSTRUG00000016113   Transcript: ENSTRUT00000041332
Sequence length 642
Comment pep:novel scaffold:FUGU4:scaffold_120:798885:802618:-1 gene:ENSTRUG00000016113 transcript:ENSTRUT00000041332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSISQSGSTAPSLALDDYSLYSHLNDDELLQLAIERSLKETHNNNVAATTSTPPPHP
VTRTCNQHSSHNPPVDYSSHNPPVDYSSQQEDLCWDSQSVYDRFREEDVSVPEDEPLFQA
IRTGDVNKVRRLVMHSGTKLMLPSKQGWLAIHQAAWYGQDTCLRVLLSAQPGMINKKADC
GETALMVAVSQEHVPCVQVLLENGADPDISNREKETPLYKACERNNTAMVAALLNHGAVV
NTRCLLGWTALQEAVCRNNVEVCEMLLRAGAKLSLTNIYGISPLFTAAQSGQLAALRFLL
KHGADINSQAADGATALYEAAKNEHQDIVELLISQKADANKPGKTGLLPLHVASQTGNEA
IVSMLIAVTSKARVRRTGISPLHVAAEYNCDDVLELLIQAGFDVNAQLSQERSKLYEDRR
STPLYFSVINGNIEAVEMLLAAGANPNMDMFRPLMVAARQCCVKTVTLLVEHGADVNACI
PTHPTTFPAVYMFSMKYLPMFKYLLDHGGHALCCFECVYGSGPHPPINITRSESSDDVPH
DRQQRTGVQFCEMISAPSICRWAGPIIDLLLDYVGHVTLCSRLIEHLNSYSAWSVIKDKA
APPRPLLHLCRLRIEKLVGHKHLKKLPLPGALIRFLKHQHTT
Download sequence
Identical sequences H2UW60
ENSTRUP00000041188 31033.ENSTRUP00000041188 ENSTRUP00000041188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]