SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041458 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041458
Domain Number 1 Region: 84-244
Classification Level Classification E-value
Superfamily E set domains 4.48e-53
Family RhoGDI-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041458   Gene: ENSTRUG00000016216   Transcript: ENSTRUT00000041602
Sequence length 248
Comment pep:novel scaffold:FUGU4:scaffold_7:2509335:2511160:1 gene:ENSTRUG00000016216 transcript:ENSTRUT00000041602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGMNGSRNTPARAANTGQADADAGSEANHRDRKAGGGMLKKLKSRRRETEKWPAVTEDEL
RALGTNITPHVLGLRAITEDYLCKPEDNVYNVDFTRFKIRDLETGTVLFEIAKPPNSAPV
ESEEDGADVDASAGRFVRYQFTPAFLKLCTVGATVEFTVGIRPINSFRMIERHYFQGRLL
KNFDFDFGFCIPNSRNTCEHIYEFPQLPDELIRQMVARPYETRSDSFYFVDNKLIMHNKA
DYAFNGGL
Download sequence
Identical sequences H2UWX9
31033.ENSTRUP00000041458 ENSTRUP00000041458 ENSTRUP00000041458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]