SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042297 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042297
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.008
Further Details:      
 
Domain Number 2 Region: 309-489
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.67e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042297   Gene: ENSTRUG00000016545   Transcript: ENSTRUT00000042441
Sequence length 558
Comment pep:novel scaffold:FUGU4:scaffold_13:2312542:2316520:-1 gene:ENSTRUG00000016545 transcript:ENSTRUT00000042441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRVAVVGGGSSGLACIKCCLDEGLEPVCYESSDDLGGLWRFKENPESDRASIYHSVII
NTSKEMMCFSDFPIPAHFPNYMHNSLIMDYFRMYADNFRLTKHIRFNTRVLQVKQRSDFS
HSGQWDVETENKDGKKERHIFDAVMICIGHHCNPNMPLQDFPGIDTFTGKYFHSRGYKTP
EEWRNKKAVVIGIGNSGGDIAVELSRVTKQLYLSTRRGAWILNRAANNGLPFDLLFNRVV
NFIIKFLPYSVFCGLGERRLNQRFDHSLYNLKPKHRLFSQHPTMNDDLPNRILSGTIQVK
PNIRRFQGSSVEFDDGSVVEDVDLVVFATGYTFSFPFLSSHVISVSENKTSLYKYVFPAE
LQRPTLAIIGLVQPLGAIMPISEMQARWATRVFKDKGCTKLPSVDSMMKDIECKKQKMAQ
RYVTSSRHTIQVDYISYMDEIAEQVGVRPNILKLLLTDPRLGWNVVFGPCTPYQYRLRGP
GKWAGARQAILTQWERVVHPMQTRPCNDPKPRRSLMWPIILSAAAVGLAAYVNRSSLPEF
LQDPTILLDKIKASLPAQ
Download sequence
Identical sequences H2UZB8
ENSTRUP00000042297 ENSTRUP00000042297 31033.ENSTRUP00000042297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]