SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042409 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042409
Domain Number 1 Region: 1400-1538
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.02e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000209
Further Details:      
 
Domain Number 2 Region: 234-342
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000982
Family Calponin-homology domain, CH-domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042409   Gene: ENSTRUG00000016586   Transcript: ENSTRUT00000042553
Sequence length 1541
Comment pep:novel scaffold:FUGU4:scaffold_4:3018833:3031062:-1 gene:ENSTRUG00000016586 transcript:ENSTRUT00000042553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDVDLSAGGNGSRRKVDIPAVAEATVDIIPLELYDSARAKIAANLRWLFAKAYGIENIP
EDLRDPFYTDQYDQEHIKPPVIHLLLSSELYCRVCSLILKTEQAASLQSHMSVIHSLSRK
GIYVVESDDTPVADEDLSCMPIKMSAHMSMIDALMMAYTVEMISIEKVVASVKRFSTFRA
SKELPFDLEDAMVFWINKVNMKMREITEREHKVKHHPLESPSHQKVRYRRDHASGRQLPF
FRVLEDLMRDICDGAALLTLVHCYCPDLMKLEDICLKEVPSIADSLYNIQLLREFANEYL
NKSFYLTIEDMLYSPLVLKHNIMVFIAELFWWFETVKPEFVQPRDLQEFKDSRVVCQPKC
TRPAVPISNATKRSFLANPDNQNSPEVCNRYFLHPEDSDTPRAGPSFSPSHPLLPLRQRQ
QKQQEDGNGMRNRSNSLTGTDGQPRGSVVAWPDKRQRPLSTLSPFMFHSATDGDVDGASG
DSVSLARSISKDSLASNILNATPKHLPAANQPPQAAMCRVNGLHASVHVENEEETLAVTR
TDASLMPKWIDATQPAATVAAKLSTDPRPAADTFYLEPLMPAALKTAKEKSVCLNKEEES
GEGPCSSGWGSLHRGDGSTSAVRRKPPCSMNQTYPPPGEEKDMSVEPLQSLVDFRPVVTS
SIDPSSKESAGVYLQSDSEESKSCQVMDTELEDQDEEEEDLDEAVTTKDPNWTRKAFEDD
EEEESAKLQEDMNVKEHEDKDLNGGSGRSSPCLSTHSQASSMASGSVRMTSFAERKAQQQ
RFGSNHDLYSSATSSQRTTPDGSESSGPLNSWRLKRDQSPSSPMGGWSRTGDGGGSANVL
ASELVQLHMQLEEKRRAIEHQKKKRDLLMARQRQKLGKAAFLNIVKKDGGRSDAFPNPLK
ADIPKDELGGEKAPPSKELMCAGTQKGDRELEGTFLPGALEADEKENNGNFCPDEELDPY
ECSRSIEQLNEAINSIQQQMMQVSLKQELLIKQNVQSPPGASPTPPLAAEKNGDSKAGAS
FHFVDHVSGSSTVPTRKPPKLSSSRGSRSKPSELKLGKEQSRVASKALHPAHSGSKTLPQ
TRHLEGGRSPKRESPRTPVKEETAERPGDVHTTFRLNDEANIRLPTRVDLTAVAAQEVSF
EECLSSTMKESELNSSDGSGRENIPSEVPRSKAPLIEVDLSELKSEEDEAVEDANSEGGE
GEQKSVLGFFFKDDRKAEGDLAKKKAAFLLKQQKKAEEARLRRQQLEAESELKRDEARRK
AEEDRLRKEEEKMRRELIKQEYQQRKQQEMFEEQKLSPKLFKPKTPKPKQRPRPKSVLRE
ESSIDVSKDSSTPDNLSNAQSGSSLSLASAATNEADSINSGGAGSQRCDSVESFTGSVNS
RATERDWDNGSTASSTTAKAEYTGLKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKKQ
ILEELEKCESNHLMILFRDSGCQFRALYSYFPDTEEILKLTGTGPKSISKKMIDKLYKYN
SDRKQFTVIPAKTVSVSVDAITIHNHLWQAKKTSVPKKNGK
Download sequence
Identical sequences H2UZN0
ENSTRUP00000042409 31033.ENSTRUP00000042409 ENSTRUP00000042409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]