SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042426 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042426
Domain Number 1 Region: 38-164,209-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-24
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042426   Gene: ENSTRUG00000016590   Transcript: ENSTRUT00000042570
Sequence length 317
Comment pep:novel scaffold:FUGU4:scaffold_2:2830587:2837446:1 gene:ENSTRUG00000016590 transcript:ENSTRUT00000042570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVCDWLHLLWLSREIASPTDNSSNLGDVQKLVQPASLKDPNFEKLKEMLVQWINSTLKP
KHIVVQSLEEDLYDGLVLHHLLSRLAGVHVSVEEIAVSSTAQIHKLEVILEELDKRLGQE
DAGGLKWNVKLIHNKDLLATIHLLVAMVKRFQPELELPPDVKVEVVVVEVSGRGIKSSTE
VEVLTEDRNTSAQPEEDPIDQLLKLEAHKVNTVKQAILHFINQKVSNLGLHVVDMDTQFA
DGVILLLLIGQLEGFFIPLHDFILTPCQSSERLHNMTLAFDLLHDTDLHVASISPQDIVS
QDITATLKILYALFRKH
Download sequence
Identical sequences H2UZP7
31033.ENSTRUP00000042426 ENSTRUP00000042426 ENSTRUP00000042426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]