SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042651 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042651
Domain Number 1 Region: 63-326
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.47e-49
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 405-445
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000562
Family SOCS box-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042651   Gene: ENSTRUG00000016674   Transcript: ENSTRUT00000042795
Sequence length 452
Comment pep:novel scaffold:FUGU4:scaffold_15:2241453:2243368:1 gene:ENSTRUG00000016674 transcript:ENSTRUT00000042795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDTFPFTSASLRSLRLEQEFQDWEDARRALAHRRSMARAPLSREVRAPPPQMRCRDTA
VHNTFMYGDMKGVHTVLKDPGMVNALLETVKEEMVWTPEMGMWTLSSKVKQTSPLRLAAS
RGHSGCVEELLFRGAEVNDDPGGSAALHDACSGGHAACVQLLLAHGAEPDLLADDGSAPL
HLCTSAQSLHCAELLLQAGAEVNARVRESRRTALHIAARRGLEEHVELYLKHGADVRATS
QEGETPLNAACSGAERPSEAGRYLRVIQRLLEAGADPRTAGRKQHTPLHNACSNCSPRIV
DVLLQHGARAAVANGLGYTPMDCLLQVVDDFQDQQLAAVARSLLNHGAKPASPKALRRCL
PSVSTLEVMLNSYESLPPCDWEVSLPPHLSQEHQPFLRLLSQRGAGPRSLQHLCRCALRQ
HLGPRCSTAVGSLDIPASLREYLLLRSDGTLH
Download sequence
Identical sequences H2V0C1
31033.ENSTRUP00000042651 ENSTRUP00000042651 ENSTRUP00000042651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]