SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042730 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042730
Domain Number 1 Region: 18-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-91
Family Calponin-homology domain, CH-domain 0.00000159
Further Details:      
 
Domain Number 2 Region: 2205-2321
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-36
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 
Domain Number 3 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-34
Family Spectrin repeat 0.0000557
Further Details:      
 
Domain Number 4 Region: 908-1063
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-30
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 1015-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 6 Region: 607-745
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-29
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 7 Region: 1227-1380
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-28
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 8 Region: 1863-2019
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 1758-1877
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-22
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 10 Region: 744-859
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-22
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 11 Region: 1491-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-21
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 12 Region: 430-529
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-21
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 1597-1701
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 533-641
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-20
Family Spectrin repeat 0.00089
Further Details:      
 
Domain Number 15 Region: 1388-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-18
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 16 Region: 1999-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000209
Family Spectrin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042730
Domain Number - Region: 1176-1237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0662
Family Spectrin repeat 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042730   Gene: ENSTRUG00000016700   Transcript: ENSTRUT00000042874
Sequence length 2374
Comment pep:novel scaffold:FUGU4:scaffold_6:2274632:2298575:-1 gene:ENSTRUG00000016700 transcript:ENSTRUT00000042874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSTISPTDFDSLEIQQQYNDINNRWDLAAETDWDNENSSARLFERSRIKALADEREAVQ
KKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPRPTKGRMRIHCLENV
DKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAK
DALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDLIDFENLKRSNAHYNLQN
AFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDY
AIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQAFNSYRTVEKPPKF
TEKGNLEVLLFTIQSKMRANNQKVYMPKEGKLISDINKAWERLEKAEHERELALRNELIR
QEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTNLGAVEAATRKHEAIETDIGAYWE
RVAAVQAVARELEAENYHDVRRVAARRDNVLRLWEYLKELLAARRERLNAHRDLQRLFQE
MRYIMDWMGDMKSRLQSPDSGKHLHDVLDLLQKHTLVEADISAQAERIKGVQGAAQRFTS
YEQAYKPCEPGLVSEKVDLLGQAYEELGQLAVKRREQLEDSRRLWQFLWDVGEEAAWIRE
QEQILASGDCGRDLTSALHLLSKHEAFTDEMAARYGPLSNSIAVGEALIKEGHFGAPEVS
ERVEDIRGQWNHLEETTKLREQSLKESVALHQFQTDANDMEAWIMETFRQVSSQEVGHDE
FSTQTLARKQREIEEEIKSHRPLIDSLHEQAQALPQAFVHFPEVDGRLPAIEQRYEELES
LSAARRQALEGALALYRMFSEAGACLLWVEEKEQWLHGMEIPTKLEDLEVVQQRFDTLEP
EMNNLGARVTDVNQVAEQLLSSDNRNKDQIHQTRDQLKNRWKEFEQLAGQKKEDLESALN
IQNYHLECNEIQTWMKEKTKVIESTQGLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLR
TEAEKLAKEHPDQAGEIQGRLTEIQEVWEDLNDTMKRREESLGEASKLQGFLRDLDDFQT
WLSRTQTAVASEDIPTSLPEAESLLAQHESIKNEVDNYKEDYEKMRAVGEEVTQGQTDAQ
HMFLAQRLQALDTGWHELRRMWENRHSLLAQAFDFQTFLRDAKQAETFLNSQEYVLSHTE
MPTSLQGAEEAIKKHEDFLTTTEASEEKITGVVESGRRLINDSNANSDKIQEKVDSIQER
HRKNKEAANELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKH
QAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVEQTLQDLQRQWEELEGTTQTKAQCL
FDANRAELFTQSCSALDVWLKNLEGQLQSDDYGKDLTSVNILLKKHQMLEHQMEVREKEV
QSLQSQALALSQEDAGLTEVDGQQRRVTDTFANLQEPLNLRRQQLLASKEAHQFNRDLED
EILWVKERMPLATSTDHGKDLPTVQLLIKKNQTLQKEIQGHQPRIDDIDRRSKTQSQVDG
ERQSVQEERLGELQDLWNQLIAETDKRHTRLIEANRAQQFYTDAAEAEAWMGEQELHMMS
EEKAKDEQSALVMVKKHQSLEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVD
KLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTGKM
LRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELID
TRTQMLAASYELHRFHQDATEVLGRIKEKREGLPSDLGRDLNTVQHLHRQHNTFENDIQA
LSGQVNQVQDDAARLQKAYAGEKADDIQRSEHAVTSAWEGLLDAGQARRVLLLDTVEKFR
FFNMVRDLMLWMDGVNLQIDAHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACIEMGN
TLLNNNHYASDEIREKLIQLQEKRDKINKKWQDKMDHLQIVLEVLQFGRDAYIAESWLAG
QEPLVRAAELGANVDEVESLIKRHEAFEKLAVGWEDRFVLLEKLTTLEEQEMQRRREEEE
RARRPPTPPPAEEAADITESHVHDSAARPRTSLDQTTLNQSVSVNGVHSDNDTSQPSVFT
HSPKVFFFPEPQGSESESVNGPGRDSGLASSRLEPSATLPNRGGAESGPETMEGMLNRKQ
EMESHSKKAATRSWQNVYCVLRKGSLGFYKDGKSASNGIPYHGEVPISLAEAVCEVAHDY
KKRKHVFKLRLGDGKEFLFQAKDEAEMSSWIRSILASVPSGGGDSPGGPRALSRAMTMPP
ISPSSAEGGGVTMRNKDGKDKDREKRFSFFGKKK
Download sequence
Identical sequences H2V0K0
ENSTRUP00000042730 31033.ENSTRUP00000042730 ENSTRUP00000042730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]