SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042891 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042891
Domain Number 1 Region: 15-245
Classification Level Classification E-value
Superfamily L domain-like 5.67e-36
Family Leucine rich effector protein YopM 0.033
Further Details:      
 
Domain Number 2 Region: 631-739
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-25
Family Calponin-homology domain, CH-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042891   Gene: ENSTRUG00000016753   Transcript: ENSTRUT00000043036
Sequence length 752
Comment pep:novel scaffold:FUGU4:scaffold_6:2377916:2392217:1 gene:ENSTRUG00000016753 transcript:ENSTRUT00000043036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARSLDRVLEDAVSSGILNLSGRKLREYPGLSYDLTDTTQADLSKNRFTEIPPEVCLFAPL
ESLNLYHNCIKCIPEAIINLQMLTYLDISRNLLSVLPKYLFNLPLKVLLVSNNKLLSIPE
EIGKAKDLMELDVSCNEIQALPAQVGRLQALRELNIRRNCLHMLPEELADLPLIRLDFSC
NKITEIPAAYRKLRQLQHIILDNNPMQSPPAQICLKGKVHIFKFLNIQACRLDKKPDTLD
LPSLGKRCLPQPLTDSMEDFYPSKNHGPDSGIGSDSGDKRLSTTEPSDDDTVSLHSQVSE
TARADALSLLSKMDSCKGYRNDENGIEKHILMLVSGAQQCLSSDKEQLVEEEDDELKEVL
DLRKIAVQLLQQEQQNRCGLPLLPIPPLSVPWAQPACFRIFAGISFQILKRALYCLRLSP
SHLIMSSTDLPLHAPPHMLLKQTNLISCLASLATLHHIVCLCRLYKSLHLGVADVSRHVG
LKQPGKPLCQSPAVTKSCPHSHVLSREQHSLESANASVALCRFLSHSGSSACLTVCSHSS
ASLDEGSSGASMHSGSLKLDQSDSESKWPEIPPVLNQNEDRKKNKYLRMFCCGATLERTQ
SNTAFSRGSRQEYNSTEPSFTMRRKMEHLREELEQIGLLRQNIESRLKVLLPDDVGAALM
DGVVLCHLANNISPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACKKIGVPQDKLCLPH
HILEERGLVKVGVTVQALLDLPPSRLMQLSAI
Download sequence
Identical sequences H2V111
ENSTRUP00000042891 ENSTRUP00000042891 31033.ENSTRUP00000042891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]