SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043261 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043261
Domain Number 1 Region: 229-270
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000366
Family SOCS box-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043261   Gene: ENSTRUG00000016884   Transcript: ENSTRUT00000043406
Sequence length 271
Comment pep:novel scaffold:FUGU4:scaffold_3:2414094:2415369:1 gene:ENSTRUG00000016884 transcript:ENSTRUT00000043406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTEPIPDQFMEFHPIHGSNVRLDHTGTQATRVDSFANGVCFSKQPLQPGEIFLVEIEDKE
LGWCGHLRVGLTARDPRGFEEVPEYSIPDLTDLGDSWVFAITRNHNKVVEDSEAAGGEGS
NNKPKMFFTDSHLHIENIWIPRDKLVGRSRPGRYSHILDDLFKTNALPPTARRSRIGVIY
VPKGSQLADMHIIINGEDMGASAKGIPTTQPLYAVVDVFAATKCVRIVQVEYGFSSLQTL
CRKAIQKHIIHRMAIDWLELPEALKHYCKYE
Download sequence
Identical sequences H2V230
31033.ENSTRUP00000043261 ENSTRUP00000043261 ENSTRUP00000043261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]