SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043279 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043279
Domain Number 1 Region: 30-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.92e-56
Family Ankyrin repeat 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000043279
Domain Number - Region: 249-291
Classification Level Classification E-value
Superfamily SOCS box-like 0.000144
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043279   Gene: ENSTRUG00000016894   Transcript: ENSTRUT00000043424
Sequence length 292
Comment pep:novel scaffold:FUGU4:scaffold_2:3656227:3658078:-1 gene:ENSTRUG00000016894 transcript:ENSTRUT00000043424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLKQTKNVMEITRTRPSLYGEIAHGLGFWTDRSAVHEAAAQGRVLQLQQLIEGGAAVNI
VAVDSITPLHEACIRGQAQCVRLLLDAGAQVEARNIDGSTPLCDACAAGSLECVKLLLEY
GATVNPPLFTFSPLHEACMSGNSECVQLMIDRGAQMEAHDCHYGTPLHVACAREHFDCAK
VLLSAVGANVNAAKLHETALHHAAKIKNVDLIELLVEFGGNVYARDNLKRKPIHYTIVGS
PPYLCLEFYENTPLSLQQLSRVAVRRAVGKRAGEVLTKLGLPSRIIRFLSYM
Download sequence
Identical sequences H2V248
31033.ENSTRUP00000043279 ENSTRUP00000043279 ENSTRUP00000043279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]