SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043381 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043381
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-51
Family Calponin-homology domain, CH-domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043381   Gene: ENSTRUG00000016938   Transcript: ENSTRUT00000043526
Sequence length 171
Comment pep:novel scaffold:FUGU4:scaffold_579:33166:34061:1 gene:ENSTRUG00000016938 transcript:ENSTRUT00000043526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLENCNYAIELGKSEAKFSLVGIAGQDLNAGNRKLTLALLWQLMRRYTLNILEELGDGQK
VTDETIVTWVNETLRQGGKNTITSFKDPSISSSMPVLDLIDSIQPGSIRYDLLKTEDLTE
EEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMARGMKRV
Download sequence
Identical sequences H2V2F0
ENSTRUP00000043381 ENSTRUP00000043381 31033.ENSTRUP00000043381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]