SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043673 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043673
Domain Number 1 Region: 2-58,92-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.61e-20
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 595-673
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-18
Family DIX domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043673   Gene: ENSTRUG00000017048   Transcript: ENSTRUT00000043819
Sequence length 678
Comment pep:novel scaffold:FUGU4:scaffold_6:3167621:3172400:-1 gene:ENSTRUG00000017048 transcript:ENSTRUT00000043819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQLAAYVSWVNSQLKRKPGLKPVRDLRHDLQDGVVLVQLIEIVGKYSIAQKYKFSILYAK
FLFLLCHSLQSFFKSAAGEVLDGVHITPQNKEESRKNVDQVLQFISSRHIRMPHISARDI
VDGNLKSVMRIILALAAHFKPSANHRAASGNVKGSTRGASSHNPRSPIALAQGAAAALAS
ARHDASQPARAACLPRYADAIWGLDMEKSVCVRALVQQYERQSPDEQVQVQSSRSVTPVV
QFSAYWSNLFYLLSSSQSIVYPNKAVKIELRPPSHSKSRDAKTVASLNSLLETGWDDPLS
ETLEKEVEDARKMVSALQALLLHGSLPEDEQDVSLGLDQGEADQQVIVLRSRLDQSMEEA
RELKRELLRCKQEMRNLQGIKDAQQQRLCTQEAAILQMKQELLRASMTKDELVNKNAQLQ
WKMEEYQRLWGDCKKEVEQRDRMLQQLKHKLEENQKTQSTRQQYSIVPPQTRGLKWKLEL
LHHCQLGESCVFVAKISLSTRHNKGLTDVKTDLTEEVQLLRDGLRSLRNNFREHDPQQHT
LDTLEQGIVSLIDRLQVMHRRRGRGKSPRRQTPHADSDSWPCTNVCQPHGGSPASTKILY
FTGKALTPSMISIPKRLGEVTLKDVKAAVDREGSYRYHFKALDPEFGTVKEEVFLDGAII
PGWEGKIVAWLEEDYGEE
Download sequence
Identical sequences H2V392
31033.ENSTRUP00000043673 ENSTRUP00000043673 ENSTRUP00000043673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]