SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044157 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044157
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-21
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 938-1024
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000118
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044157   Gene: ENSTRUG00000017236   Transcript: ENSTRUT00000044305
Sequence length 1401
Comment pep:novel scaffold:FUGU4:scaffold_1:5914560:5929389:1 gene:ENSTRUG00000017236 transcript:ENSTRUT00000044305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRNSKNGGGVLIKIITFKNYSCNDFRAALENGVLLCDLINKLKPGIIKKVNRRSTPIAGL
DNVNVFLKACGKLGLNVSQLFDPGDLQDLSTRVTLRHNESKRRLKNVLITIYWLGRKAHL
DAFYSGPQLNFKAFEGLLGLALSRALDEGANLKDGWYPDGEEDPQPRRRSTAQTSVDSGE
SPRNLHPSSEGTTPKSPSQGCESDAEAEQVFKMETAQLSPQRNRGRIPLPPPQRKQSLEN
GQYCTGPLASNRGKPPYAPQTPAAITSPKLAVNEVTFRRALSEDHSEDDFAEADPVRDDL
FLRRLRQTLRQASSCPRFDHFLPRYWTPEEETRVHAISLGSRRRPWYHKMQQLSFSNFCC
ALVLILDESKCCCSERTANLSVLCGSSRRASRAAEEERSVGFLTWFLASINGPPGSAELQ
KRAANPKHGSYEVLIYPKGGEKQLLIVMVLLYCAELSAVLCDIETLERKIKGLPELIQGR
SRLGDQFRSTPAGSGKFYTLKPERNPTAALLLVTSPSCCCSDSSSCCHLFCHVIRLRAAL
PLTLGTRSKSLSDIPMVYPVRKVPRGRIGKGVGRGDDGREWNSDKDLCTAVAEDGDALWQ
DVSAERAKPSSRCGHTAARGRLSLKSKAPKINGPFSTPTLFQDLTKWKNRRRSTKSDLRR
KSQDREHVINQMTNSARTNFERTEAGVPLERAQQSPSSNGPAPRAASSSSPSKPSGFDLQ
PRTRALLTRSYVTEVTLSPAASVVPLSSTNTQAPVYTPENRQNLETSGTSVERGPGPQVS
GRYKYLAQTGSWARSASLPRGYRRSEGSCRLSSAITARPFGNKQSRVSSLPRLHNLKSRW
TTTRDRCPNETKTDLHPHPSDHRSKAPSRQNNGNQTAVTDATPFQTPPPPQVCSSLQDNP
GKSPTVLSNPCSDHTQNRLHVIVRLNHKQVPRASDRGDFMRVSLTLKPNSRSDFGFQTRR
DSRGATVQFIQPGSPAELCQLRVDDEIVTLNGVPVAHMSSSEWMEKMTSSLRAGSLTMDV
RRYGNKAGDARSGARQANGGALSPVQVAHGKVALGEFADNHRTARSEGNIRSKASHDLNI
INHRRRAEFFQTGGSESAISDLQVPSLSPSSSSWMWNYEERRRQQKWQEEQERLLQEKYQ
RDQERLEAEWQRAQQDAMEEEHRKFIALKKKILFTSSTSLEVTIKPNNQKVIASEASGGG
RGQLMNGRTSRLSEQDQTPHSVTVTSDPRCDAQAAQNGRNIKGWAEECCDFARLSQSHRS
EGKPARTVSKKLALNWFSDIYTIRSFLSHLRRAKSMSTPSLAAAPKQTRGQCPGLSSGHA
AAVCWPQFNLHPLADSGEERKRREPSVSKVEQQRQQILEEMKKRTQLLTDNSWIRQRSSS
VYKEPIYVPLKRFESLDNLDA
Download sequence
Identical sequences H2V4M3
31033.ENSTRUP00000044157 ENSTRUP00000044157 ENSTRUP00000044157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]