SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044262 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044262
Domain Number 1 Region: 27-180
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 
Domain Number 2 Region: 203-276
Classification Level Classification E-value
Superfamily GAS2 domain-like 5.89e-25
Family GAS2 domain 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044262   Gene: ENSTRUG00000017276   Transcript: ENSTRUT00000044410
Sequence length 314
Comment pep:novel scaffold:FUGU4:scaffold_1:6558863:6565258:-1 gene:ENSTRUG00000017276 transcript:ENSTRUT00000044410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNCVLGRYRRSGPGLASPQEYHQWLPCRHDASLLPMKEDLVSWLNNLMGVHLTADSLMDG
LDNGVLLCQLAQLLQEKMIHTNKVSQPFMRRAIHWRADAASGTFFARDNVANFLYWCRKI
GVDEAYLFESEDLGKVLHKQPREVCLCLMELGRTAARYGVEPPGLVKLEREEAGKSPLSP
AATSPPPALTSRKSTPQRCTATNILDDIVRNITESPPCSCPTRFLIKKQPKGCYRVGDKV
LYIRMLNERQVMVRVGGGWETFASYLQKHDPCRGGGPTGRSDVCRNKVRPPALNSSPDSY
MVVGAHCRAKKEIG
Download sequence
Identical sequences H2V4X8
ENSTRUP00000044262 ENSTRUP00000044262 31033.ENSTRUP00000044262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]