SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044413 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044413
Domain Number 1 Region: 188-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-45
Family DBL homology domain (DH-domain) 0.0000000553
Further Details:      
 
Domain Number 2 Region: 381-505
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-30
Family Pleckstrin-homology domain (PH domain) 0.000046
Further Details:      
 
Domain Number 3 Region: 114-177
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-23
Family SH3-domain 0.0000872
Further Details:      
 
Domain Number 4 Region: 5-62
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000089
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044413   Gene: ENSTRUG00000017333   Transcript: ENSTRUT00000044562
Sequence length 802
Comment pep:novel scaffold:FUGU4:scaffold_313:175115:185674:-1 gene:ENSTRUG00000017333 transcript:ENSTRUT00000044562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFQFLPEPRSDNECQRNITEFINGCGAFGVETFEVSDLLQGLNFSKVLNALVALNKATEG
LGVPEDNVCVPPSSTLRIKSFDSLNTQTTRSSKLLQPQYRSLDMSEGNGCGNLLVKARFA
FQQTNEDELSFSKGDIIIVSRQEDGGWWEGSYNGKSGWFPSNYVRELKGSDKTSDKPKSL
TMKSPPKVFDTTVITKTYYNVVLQNILEAETEFSRELQSVLGSYLRSLHPTDRISSADIG
HILGNLEEISTFQQMLVQSLEEHTKLPDSQQRIGGFFLSLMPQMKSIYVAYCSNHPSAVN
VLMQHSEELGEYMESKGASSPGILTLTTSLSKPFTRLERYPALLKELDRHMQDQHPDRAD
LQMCMAAFKSLTAQCQEMRKKKDLELQILTEPIRNWEGDDIQSLGPILHMSQTTVHTPTC
QELSECYLVLFPHTLLMLSASPRMSGFIYQGRMPLSGMLISRIEDGENLRNAFEISGSHN
ERMQVACITQQDLQDWLDLLTKHTHTPTPHTPSYKHQSVCHTLPSHPGTPSRLSESHGGS
TVQTYHTLPHPTSFGTLHSNSLTWGPLEPPSTQKPWSLSCLRPAPPLRPSAAHCQKEDLS
KSPKNMKKLLPKRKPERKPSEEDFTVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTW
QGTDLMHNHVLADNSLSVAGFPGNLPCSDQSEDSDYDSIWTATSYRTASISRSSRKDVQM
LFPEEEKIIIEETKSNGQTVVEERSLVDTIYSLKDEVQELKQDNKRMRRTLEEEQRARKE
LERIIRRVLKNMNDPSWDETNL
Download sequence
Identical sequences H2V5C9
31033.ENSTRUP00000044413 ENSTRUP00000044413 ENSTRUP00000044413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]