SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044828 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044828
Domain Number 1 Region: 385-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.22e-31
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Domain Number 2 Region: 86-235,375-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-16
Family HI0933 N-terminal domain-like 0.098
Further Details:      
 
Domain Number 3 Region: 962-994
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000111
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044828   Gene: ENSTRUG00000017484   Transcript: ENSTRUT00000044979
Sequence length 1026
Comment pep:novel scaffold:FUGU4:scaffold_14:585687:598486:-1 gene:ENSTRUG00000017484 transcript:ENSTRUT00000044979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEMEEERDNVGKLFENFFQASTCKGTLQAFSLLCGQLDLDPADSSTFYSSLKAKVTTWK
AKALWSKLDKRMSHKEYKKGQACVGTKCLIIGGGPCGLRTAIEMALMGAKVVVIEKRDSF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIQQLQLILLKVALIVAVEFHISV
EFVKLLEPPEDQDNEGIGWRAAVQPADHPVANFEFDVVVGADGRRNTLEGFKRKEFRGKL
AIAITANFINRNTTAEAKVEEISGVAFIFNQKFFLDLKEETGIDLENIVYYRDNTHYFVM
TAKKQSLLDKGVIINDYTETQMLLSNENVDQEALQCYAREAADFGTNYQLPTLDYAMNHC
GQPDVAMFDFTSMHASENAALVRERFGHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDT
AWMVNSWAQGHTVLDVLAERESIYRLLPQTTAENIAKNFEQYTIDPGTRYPNLNCCNVRP
HQVRHLYIRGELSACSLERAATIRRPVNLSRRESDVRPSRLLTWCQKQTEGYRNVSITDL
TSSWISGLALCALIHRFKPQLIDFDSLHGEDHAANLQLAFDVSEREFGFRPFTSVEELHG
GQELDKTKMITYLSKFYELFRGTPLPASAGSRGADENNEDYPSKQVRSNNFLNLASTRKR
VPKDEKKSEGLDPLYKRKRKFYLEEATNLSSNGSLTREPRENKVRSMATQLLAKFESTPR
YTVRNSQLQFVSSFKFKMSLSEAAGNLVHLPPQCLRKPKSQPQPQFPVVRLRHVEGARRQ
AAPDPPPESDGASAAAPSRRSAVEFMTRVLQRLREVDEHVSEKKAQAQQAREFHKKSIKE
KAVHLSGLFTGGGSAQPKVTGCLTPPPHPGLGATCLLSPAHLHVERRHVARSSPFFRVQC
FLPSHLQLFLFSTITFTHAELAAGGSGCLSACDEVIVYLKLTVSTPATSAVPFQGDSVRR
AFPPSGDKCHSCGRRVYMVERLRAEGLYFHRECFRCSACGCTLRQGAHAFDSEHGRCCQL
YCQLHF
Download sequence
Identical sequences H2V6J2
ENSTRUP00000044828 31033.ENSTRUP00000044828 ENSTRUP00000044828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]