SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000045907 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000045907
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-59
Family GDI-like N domain 0.000000000707
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000155
Family GDI-like N domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000045907   Gene: ENSTRUG00000017904   Transcript: ENSTRUT00000046061
Sequence length 447
Comment pep:known scaffold:FUGU4:scaffold_371:30337:35055:1 gene:ENSTRUG00000017904 transcript:ENSTRUT00000046061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVKGKKVLHMDRNNFYGAESASITPLDELYKRFSLPG
KPPESMGKGRDWNVDLIPKFLMSNGQLARMLLITSVTRYLDFKVVMGSFVYKNGNIYKVP
STETEALATKLLGLFEKRRFKKFLGFVANIDVNDPKTLDGVDPQKTTMRELYSKFSLGPD
VVDFTGHALALYGTDDYIDRPCIETINRIKLYSESLARYGQSPYLYPMYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIMEDGKVVGVKSDGEIARCKQLICDPSYVPERVTKVGQVIRV
ICILSHPIANTNNSNSCQIIIPQNQVNRKHDIYVCMISFAHNVAAEGKYIAIASTSVETN
DPEQEIKPALDLLMPIDQKFVSIADQYEPTDPGTENQIFISRSYDATTHFESTCDDIKNI
YNRMTGTEFNFAEMERHKKDTFGDAAE
Download sequence
Identical sequences H2V9L7
31033.ENSTRUP00000045907 ENSTRUP00000045907 ENSTRUP00000045907 XP_003978432.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]