SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000045926 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000045926
Domain Number 1 Region: 23-231
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.79e-57
Family Ankyrin repeat 0.0000993
Further Details:      
 
Domain Number 2 Region: 246-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000837
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000045926   Gene: ENSTRUG00000017913   Transcript: ENSTRUT00000046080
Sequence length 288
Comment pep:novel scaffold:FUGU4:scaffold_371:36556:38797:1 gene:ENSTRUG00000017913 transcript:ENSTRUT00000046080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGPVPIRQSWESIWQLIGDLSCWSERTEVHRAASQGHAAQLQHLIQSGASVNMVAVDS
ITPLHEACVRGQAECVQLLLEAGAQVDARNVDGSTPLCDACSAGSLECVRLLLEHGAKAN
TALTSRTASPLHEACMGGNADCVKLLIAVDAGLEAYDLYYGTPLHVACANDDINCVKVLL
NAGAKVNAARLHETPLHHAAKNMRVEMIEILVEFGANVYARDQHNRKPVYYTTPGSPSAG
CLSFYENIPMSLQQLCRLALRNWLGPRALKVIGQLQIPKLLIRYLCYQ
Download sequence
Identical sequences H2V9N6
ENSTRUP00000045926 31033.ENSTRUP00000045926 ENSTRUP00000045926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]