SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046184 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046184
Domain Number 1 Region: 46-72,196-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-54
Family G proteins 0.000000121
Further Details:      
 
Domain Number 2 Region: 76-200
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.36e-39
Family Transducin (alpha subunit), insertion domain 0.000000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046184   Gene: ENSTRUG00000018031   Transcript: ENSTRUT00000046339
Sequence length 377
Comment pep:novel scaffold:FUGU4:scaffold_339:106871:110655:1 gene:ENSTRUG00000018031 transcript:ENSTRUT00000046339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFLPTRSVLKVCLPVCLLNSSEVEQLRKSKEIDRCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQHAREEFRATIYSNVIKGMRVLVDARGKLHIPWGDKDNQQHGD
SLMAFDTRSAKMASGQLETSVFLQYLPAIQALWADSGIQNAYDRRREFQLGESVKYFLDD
LDKLGDPTYVPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLDIFETIVNNRVFVNVSIILFLNKTDLLEEKV
QSVPLKDYFPEYTGPEHSLADIQAFMVECFRARRRDATQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
Download sequence
Identical sequences H2VAE3
31033.ENSTRUP00000046184 ENSTRUP00000046184 XP_003978181.1.43653 ENSTRUP00000046184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]