SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046370 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046370
Domain Number 1 Region: 17-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-114
Family Motor proteins 0.00000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046370   Gene: ENSTRUG00000018115   Transcript: ENSTRUT00000046528
Sequence length 1372
Comment pep:novel scaffold:FUGU4:scaffold_14:1742583:1748812:-1 gene:ENSTRUG00000018115 transcript:ENSTRUT00000046528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKVPGAQSRGDYSAVQVAVRVRPLLPKELLHAHESCITVDPELHRITLGHDRHFYCDH
LFEETCCQEDVYSASVQPLVDAFFQGFNATVFAYGQTGSGKTYTIGEANISSFMDEEQGI
IPRAVADIFKLLDENDLTDFSVRVSYLEVYKEEFKDLLEVETASKDILIREDKGNIVLCG
VKECEVEGLDEVLSLLESGNTARHTGATQMNPNSSRSHTIFTVYMDQRRGGSRLYSSASS
MGPQVLSSKFHFVDLAGSERILRTGNTGERLKESIQINSGLLALGNVIGALADPKRKGSH
VPYRDSKITRILKDSLGGNSKTLMIACISPSSSDFDESLNTLNYATRARNIQNRATVNCK
REPDRVEGLEQQIKALRRALENRQRSETRIISHADPNKRPRLGEGEMSRLQAQSAHYRMC
TDTAYRLLQELLSEGALSTEQSLRVNEWLCSVEEERSGLTTASGPDSGIDNSSAEETAAL
RRARPSVKNQGPEGAEESWRHEHESEKEDAMVQLQVQIQRLESENTDFLAALEDAMEQYK
QQQSDKLQEQQDLIEELQCHLSAPALLGLGLNLRSRPHTAPMGSLQHGQNGGCSRQGFAI
MLLFSLSVLVLIWGCVRFQLGTCDQDSRLLEEELAEMQQTEEENPFAISQERHRPINLTW
TKKDLLSQGLAASGLPAHLPEPEHHACFARKASNSSSGEMSLVGSLKSLEGRSELGLLQA
QQKIRELSVTIRMKEELIKELVKTGKDAQALNKQYSHKITALENEALQARQELQEAQRQL
QELEKQEREISATDRSRAQECRRKIAAAQSKVQVLRQRQRDTARLANLPAQSERRVLELE
RSVQSMRQQQEQLQKRLREESQQKRRLETEMQRRTHRVKELEIKNEQQQKILRIKTEEIA
AFQRQRRSGSNGSVISLEEQQKIEEQKRWLDEEMERVLEQRRGLEDLEGELTKREEILAK
KEALLQERSSLETKRLRSSQALSKDLVMLTGRIESLERELSERNGLLRSSSAQDSQQIRQ
EISNLRQEKDSLLKQREELDDKLRQGNLLSPEEERTLFQFDEAIEALDAAIEYKNEAITQ
RQRQLRASASMLSQWEMNLMAKLSYLSASETRALLCKYFDKVVSLREEERKLQLALAELE
MQLDERQRLVQWLENALDRTQLDTDRRLTQQQKEHERSVQLLLQQCREQIDEGLAGKQRQ
FEGWIHNLNKELNHYKAVNVELSNKLKEFGGSASQQKEHIKVIGPDNKPAGTNTMDKLTR
CPEDTTGGRETGQSDRPPRSREEMRELVNTPLPSTWRRSSLPSEETSLVEELRLRAAGDA
PANRVVQPGPASWAGLAALPVVKSRRESRRSSLNIGPLVSNNAFIDVRKNPV
Download sequence
Identical sequences H2VAX8
ENSTRUP00000046370 31033.ENSTRUP00000046370 ENSTRUP00000046370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]