SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046423 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046423
Domain Number 1 Region: 1409-1543
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.35e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000366
Further Details:      
 
Domain Number 2 Region: 255-359
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000223
Family Calponin-homology domain, CH-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046423   Gene: ENSTRUG00000018134   Transcript: ENSTRUT00000046581
Sequence length 1548
Comment pep:novel scaffold:FUGU4:scaffold_49:203335:214915:1 gene:ENSTRUG00000018134 transcript:ENSTRUT00000046581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKTVRKSQCILRGESLLCLHLVMDAGAGRDSTWRRTAAAAGGAGGGVVPLELYDSARAKI
EANLRWLFAKAYGIDHIPVDLRDPFYTDQYEQEHIKPPIIRLLLSGELYCQVCGLILHAE
QAASLQSHQSVIQALSRKGIYVLQPDNTPVSELDLRSTPIKMSAHIHLIDTLMMAYMLEM
ISVEKVVSCVKRFSDLSSKELPFDLEDAMVLWINKVNMKMRGIMEKEQKMKHHLLESPSH
QKVRYRRDHLSGRTLQHFPLLEDLLRDVCDGTALLAVIHFYCPDLIKIEDICLKEVPSIS
DSVYNIHLLKEFSNEYLNKCFHLKPEDMLYSPPVLKNNVMVFIAELFWWFESVKPEFVQP
RELQEPRDVRFLLQPKGSRSHGLNITKRNFMTSSNSADTMTTSLSPELSTCKNCELNKPH
LSFLCSSNPISSRAPSLLPIQHRYQKFPEEGTLEPRKRSSSVTHTDSQHQGSLLAWSDRR
PRPLSQLPPYALHYPPDDDADSISLARSISKDSLASNITSITPNHLRRSGPQRSQHRLSG
QSLLSHMHIEDEEEEIEEEELVAVIHPSSFARVRLGSDMEQDELDISSKPFKTHCSTYDD
MDRFTSEHPPDRYYLEPLMPAIPKAAKEKSISLNKEEESGENHHRAAAAAAAVRKVATNF
PITPQRKSPVAAQSNLNTVTPSHVVEPNSVRPPVEGSVDQSEEKESQGFFLHLSGESEYH
STFSQEAGQDSDSDIADLDEDEEEQEQLSKEEEKHGRKKYFKDGELRDFAEGESAKLRED
LKVSEREDKEDCSGQSSPCLSTASWASSCSASGSSNIKMTSFAERKLLKLGLREGFSSTS
SSQKTTPDGSEVVACPPWQLRSDSTSSWMGKEPVSMLVVPTELLQLHMQLEEQRRAIEYQ
KKKLETLSARQRLKLGKAAFLNIVKSGGKSDTLPLPLKHPESAEFADRGKAKTPLCKDDS
CLDALKVQAKTGQTERGEIGGDNKLSSSKGAEPDRNECSHSIDLLNEAISSIQQQMMQLS
LQQDMLMKHVVSPPEQVELDPSTTSNATQPAPSTSDPRCFAVHFVDLGESSTPVRRPPKL
SSGQRRKTEQKQSNDSSKTLSVKSNTPSPPDNSGRDQQIGDVPESSKMEKSIQRNATFKV
HSDVSTHHGLEPDTDTVSSTPVHQSPPQTAQLEENQLYNSGKAAAGGSENTRLKGQLIEV
DLSELKGNADVADPPMDSEPKNVLGFFFKDEEKAEDEMAKRRAAFLLKQQRKAEETRLRK
QQLEAESELKRDEARRKAEEDRIRKEEEKARRELIKQEYLRRKQQALIEEQGLVKPRPRV
KSGRSRPKSLHRVESNSLTKGSTTSDLSCSHRGSTLSLATEADSVISEESQRAESVCSMD
SFPVLSRASSRNMERDWDNGSIASSITSVEYNGPKLFKEPSSKSNKPIIINAIAHCCLAG
KVNESQKNAVLAELERCESNHLIILFRDGGCQYRAIYSYSPDTEEMVKFTGTGPRAISHK
MVDKLYKYSSDRKQFTVIPAKTVSVSIDALTIHNHLWQVKRPVSARRK
Download sequence
Identical sequences H2VB31
ENSTRUP00000046423 31033.ENSTRUP00000046423 ENSTRUP00000046423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]