SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046505 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046505
Domain Number 1 Region: 1-120,150-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-75
Family Calponin-homology domain, CH-domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 6560-6702
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 7005-7135
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 4 Region: 2687-2811
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-16
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 6669-6805
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000236
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 3128-3252
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000263
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 7 Region: 3282-3390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000222
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 8 Region: 6341-6480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000264
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 9 Region: 548-689
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000792
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 10 Region: 5285-5409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000222
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 11 Region: 1481-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000034
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 12 Region: 3764-3881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000792
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 7090-7246
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000374
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 4125-4280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000111
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 15 Region: 5506-5652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000149
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 16 Region: 4282-4393
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 2469-2623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000631
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 18 Region: 5102-5209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000116
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 19 Region: 4820-4961
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000449
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 3509-3641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000763
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 21 Region: 3613-3751
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000116
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 22 Region: 3433-3539
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 23 Region: 2364-2481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000033
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 24 Region: 6492-6596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000966
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 25 Region: 2837-2953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000111
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 26 Region: 5662-5780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000202
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 27 Region: 6931-7038
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 28 Region: 6135-6218
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000339
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 1656-1717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000112
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 3914-4061
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000131
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 31 Region: 3060-3141
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000504
Family Spectrin repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000046505
Domain Number - Region: 1989-2082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000114
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 6264-6377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number - Region: 2106-2208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000763
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number - Region: 5956-6063
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0023
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 1728-1855
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00268
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 4673-4804
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00911
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 954-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0307
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 5176-5272
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046505   Gene: ENSTRUG00000018176   Transcript: ENSTRUT00000046663
Sequence length 7292
Comment pep:novel scaffold:FUGU4:scaffold_78:491126:560059:1 gene:ENSTRUG00000018176 transcript:ENSTRUT00000046663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQEAVQKRTFTKWINSHLAKRVPPLIVTDLYEDLKDGVMLLALLEVLSGQKLPCEQGKK
LKRIHWVANIGTALNFLEGRKIKLVNINSTDIVDGRPAIVLGLIWTIILYFQIEELTINL
PAIQALSSSNSSLDSSTSSTDTTSSPIKRNPPRQGGARKALLRWVQHTAAKRLGIEVKDF
GPSWRTGLAFFAVIHALRPSLVDMERVCRRPNRENLKEAFFLAEQELGVPQLLDPDDVDV
DKPDEKSIMTYVAQFLKHHPGQKESDSDEQLIEEVTMVFSGSSLNNSQNTQFKREQRKSL
RELKMWLDQLESDAVQAQETEGSLAQQYQLFKSLHVQLEMRRKQLEQSLQSTQRDGILTV
DQALVKQAWERVSNTLLNWHLHLDRSLPAPLDSVGAWLHEAEGALRQEVVIHQAHDVTAN
TVHRALEHHKVSQSGTAKDLLKSLKSHQQVFQRIHNDRSVNGVPVCPDQLQDLAERMNFV
SMSCNAHFAKMKFLENKHQMQAFLTVAESKVKSWIIKYGRQESVQLILQSYVSFVEKQHF
FEKYESLFQSLKQSAEAFVTADSSADEGEMGVRRFMREVVTQWRSLSMEVRSVRSMLEEV
LSNWEKYSSIVASLQAWLEDAEGALNQQENIKKEFFRNLSHWIDQHAAMNDAGNFLIETC
DETVSLDLKQQLLILNERWRDLFLKVKQYASVNELDKWRKDHLKAVSAMKDLLDTAELKL
NAPVQVSFLNLRAFLSDVETVKQKVVAMETQYKLAARSAQLLGKEAPADEAARVMATMTT
AKSQLSKVRERCPTLVRECHMLLPLLEEMEKHITAFYQSLERAGRITSAARDPNTQIWSH
QKQQWQVRYNHNGISRLNTTIIDTIHLLCTITETHSLSLKKDLLNQQQGCKRSLSVIERN
YHTLQKALSTSKVFRNLDLFLLHKRVAEIQSSVITTVGSHQCPLSQALLKEVGEWRRHEE
SNNCLRRRFEESKQELEQVLQRAQSCLQETGDAEVLLRKHGDFFDQLDHRVLSMFLKSCD
ELTDILPQEEQQGLQDTIRRLHKLWKDIQGQVPSHMLRLKVELEQNRVAAVIEDCRAELD
REMNVLSDTCTSEQVIQEHRTYFRAHNPHALCEKGIRNMEELCLQLPDNDPAHHTLNSTR
RAVAEVTEQIRSIHIKLKQHPDKWEEWNERFCKLSDWLSSQTAQVRLLREATKYLSHQEQ
ADTTVQELLKKAINIKQDNLWWLKSRLVELSDVSSDSEVQRQQTALAKLSDDLQTLFSSL
CQVLKCVYIFSASAVFQHEVIEEEAHDEMDEHPMKTEKTRSQIILDSRKAEEAKQLYLCH
QVRLHLFSLLSFYVQHLGSFCHQKGEGALRSSELDDASRDTGSESGAKEHSLQETMKSWK
QFESDRESVWRFITNINNELQRKHTFSCLDILKSELEQSKEFLMKAEVYSIQADLLLGKA
AGIQPGTKSDTLTQQARSTREAVTQLQDRLNEQYYICIVEMERVCMWWEHFSSESEAFSL
WINEKEKELEAVSSTSSLESLDKHINTVETVGEGLGKGRAALAHMESDCEALLNFLTPGK
ADHIRAKLEGMRLQWEELKFKHERMDRRLSLSASYRDTEDANQVKKSMDHLKEKLDCPIM
YCISSSDTYRNLLDHMEVYQAVEQINPGLSALSSLVKRHEGGHPLVKEITQLKTQQQEMM
GKVKEKQSTLESLVALWQRFEKESSSMRSWLDRCESVCCPGTDLLSADKMKLRTPESRIR
ELRDDLTQIQERCASVKNSIKHRQNLLDLHLSHLEQFDQALRTMSQFSENFLSSLKTSSQ
VDVTDLEAAINTLMEHEMQLESHAPLSETAQQIEMLLLCSSTLEAQQQIHNWREASQQPV
SESHRLLKLRKECLTQLKTFLEQHGTVATAVRHLHELAGSRGSWDSSKADELHRRIGEIA
TDLARLEADAVGIDGQLSKAHLQLSGDLKDERTSCWGQVVALTVALEEVQRCVGWRQSEA
DCIRALRSSFREKKDEVLNILTKMEEEATQAGIQESSEQAFQNRLQFFVQLEDELQSLQH
SLRWLEEKGSQLAHRDSELAAEALRDVALVNTAWEMVKTLITNGQEQSNIVIELLHQYTY
LKMTLNTVVESALSVAHNLPDHNHNAQEAKRTFERHEAVHTELREKQEDMDQLISTVEDL
QRELEKVPKFEGCFSQKDTEALRNQWLEASERIQTNTERLEYCVVLWDDLKSMEQDINQW
TSSSIAELTNSVTNLNDKDRTQALLATFQAEMDKREQSLDVLQDRVMKVKECAKLQKTPL
QMQVLESDLRMKMAHAQEVYNQAKYTLTYFCFKKQRLEDLLSQMTERLKAVEGSLSDLTG
ATSHGDIATLKDLQGIVQQQRADIEAARDALTALCRSHPSQELADLSSELTSIAKRTEAV
AQCCVRTKSDLQDGLQLHFNELVQGFNSWLANLKSTQTECSNQLGDVPILEARLQRLKMS
VEETSEGEERLSLLCEEAKKLQLHLPKASVPQIQDHLSSCQREWENFLHSCSQNQRELNE
SIDLLKNLNGCVEDIRNWLHQTELSLRKEQSLGAESQQGASDAAEQLERLENLHKELLDK
RRRSIEGICQEAQSLSEGGRGSGEEVKVTCQLQLEHQALLKTARERLYICQESQALGETL
QGFWSWLEEIQERLGTVDSTMGTKEQLEQRLETVQDILLLKGEGEVKLNMVMGKGELALR
SYGATGQEVVRSQLQEVDDAWATLLVAAMSCHSRLEWTVSQWGSFLHSAAQLRCWMEAVG
REVRTPLTPQPGPREKASQLERLRALLSDLEDHQVPLSSLEEKARELLKKTGDTSFNQGA
RSQLQVQFDNLTSMVEERVHLAQAVVLEHQQYLEAVKELTDWLMTAGEELQSWSDASGDS
ISVRKKLTEVRECVESRLLEGRERFSRVRKSAASTAEHTAAGGCEAIDRQLGALSQALEQ
WEGAALRARDGLEVALAAAETSEEEYKRLTVQLEDELKELEGRLKWWSQELIKAEGWSNG
EEAVKGWQLAKDILEGLHSAEPMAEKLKGQLNNLVQFSRDVSPQSEKVTALIKQHNSLSL
RASRECQNKERLLEQRFRAALRDFQQWLVNAKISTAKCFDVPQNVAEASNALQRIQEFLS
DREHGQARLSTVRASGELLILVVSKDRVEGIKAKVTNAREDWKSLMSNLQMREDALKNLQ
SQMTEFEASAEPLQEWLNTTEVRVQESSVRLHDLPAKKQELNKLQCVLEEVASREAELGR
LREKAHHLWEGQAAGKGFVHRVSQLSAQYLALSNLTKDKASRIERIVGEHQLFSQGLKEL
QDWLCEAQRVLNTCVSSTIDKSTLEDRMLQLEALLAARQEREIQLKMLLTRGEAVQRNTS
AEGVPVIRKQIQDLKDSWDLLLSSCIRCKRWPSSSLSISQLEDRQFSEMRDKTANLGKTK
NALSKAKGLVLVHQEYQRALHVFEEWLEQEQATLASISHPDGNVETLEKTLEQLQLLQDR
CSNGQSLLSSVLTSREKVIPWGVPQIEDRALDTAQREWGAYQGHLEETHSHLSSTLGRLK
QMGQRFLILAQWLEEMEKAANVRQNRRSDKLTKDTQLKKLQGCLEVVLSRQVEVDGLSSL
TQEALEETCISSHISVTATQLIAQYHSLLLNIQGSIKQLQEELKSIEDADNICSTFTEWI
SSTQKGFAEVTDGSEPQDRVAIERMMKKLEALQSELQNGHGILKSLREQAEQAASFLTEA
EAENLGCEVETRLAQLEELAGRLRQKHSFLQRALSLMVQSHDGSIKSVIEKGDTLLASIH
YSSVRDKTNRLKKHYSDLCNVAMSHVETLEDQVKEQEAYHKELQEMERWLLQMSSRMVTP
DPTVCGSLESATQQLASHKVYQSLGNELQRHVSLQDTLQQCQTWLSSIPEAGEPAAHPSL
SLESALCQVKHERALQEQASTYLQLVCSTCDLSEARVRETAAAIQHVRLQIEERMLLCEE
LANNWRDIEEQKAELEVQLRETEQQLENLIRGPAELEPRIAQNLLDRAQEFLQQIREKQS
EVTRLSEALGKLSDGKACLLMDEIRRLKRCWRDLSQRAEELEAQRGEDMQRSVEFQEAVV
SVEELFHQVSREWDYLARADTESTSEHLEALKKLSSDLEGQRTTLEDLRDQKHAILPRLS
LLDKELVKQQVGHLEQRWCQLQSLIQEKIHNSAQTLEDLARIQSKLKDACEGAKEHQPTV
NSALKTSPPPDLAQSFLFEHLSACVELEARQQQLDHAISEAQSASSRLGLSEKRGLQELV
DQAQTEMEALGADVAQRRKKYFQVDLDKICHWLKEADAITFPELNLSKTDDTSELQTELS
NIHHVLEQASEYENLLLIVQRIGQEILPTLNEIDHCYLDERLNALPQQYNSILALAKEKK
DRVQQIILEQKEFSTFFGVTRNALEELQEQFDNLEKQTISIREEEFACLINEYRNIAKSL
FHFSPAVRQLHGKNEGFICRGQQCRAEETQQLVTLHNTLKRTVSHKIQHLDSCLEAVVEY
NQVLTMFSSELKAVKEKLAGIKVDTKRDAIDKISVLYSLLDRLDHFGCRAEECSQQIKGL
VVKFDPSAFEEMTLQLKSLQSLTLEVKCCVEENETKSMESVDFVKETEKLMEWLMTLRDE
LEEPLSFSEVKTGRIQEEICKLNAINEALKSRIRIGDALCTREKQKYCNRKQAVPTHIEE
KIKHMERLQSEVQQAVIKKKLAADQALSLVQRYHLSLQSMHTWLDCATAALQRASTGVEL
ENQTDCVEDLEDVLAQETHFTAGLEEQRSLNPLLGDFMEVGVMSKLKEKLDAVQLRKAEI
KQQLDVHSLVAHIDLLELPVNALKENASELEQIISESSKAITSHSVSSLWQRWTRLRSVA
QAQERTLEDTLREWRTFTGKMEKVRSVSQDLNSRVPDSSVEKAATRAVLQNLLEYHDSFI
MEVEREQSILALLFQQSRSLRSAEDAEVVMEETRVQQELREREDVEKELGLVKGWIQDTR
GLLLSPTADLESLLQELETAHGEVISRRQSVERMMELQQSKYQDLQAALPSELSMQLAEV
ALALGSAEDQVQAREREVQQTRDVKEDFSSRLHEIETKLNSIALKLQAKGVNLEEAKEET
KAEKELQEYQSMKAFILGWTEKAEVLVTSSIVWSSASQLQEQIRAHQALLRECRGLHGDL
EAMGEREEQLGEALQTESWEQQVKYLSRCTEELQQTARTRLQSLQDAAKDMLHLEAEVKN
LHAAVEQIQVTLASPDLHRLSLREQLTQRQRLLVEMEGFKQKVVAVQQCQSALWLPEEVV
TSLPICRTAQCLQQEASQLQHTTIQQCNILQEAVVQYEQYEQEVKNLQRLIEEAHRIIQD
RPVSTSNIQELQAQIQHHEELAQKIRGYQEQIALLHSKCKMLTVKAKHATMLLTVSEVEG
LSDGMEELSDEELPSARPTSQQLPAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEVSSP
PACRSPSPGANADAPLNQVLQRPPALAAPENIQYGHSTISRAPIQELYDPSMKTSTANLD
DLQRSWETLKNVISEKQKSLYEALERQQHYQESLQSISTKMESIEGTLNEGLEPNKSPES
QMAAHQALMDEILMLQEEIGELQTWFSEELADSDGEGEAGDQLALQSTLTVLGERMATIR
MKASGKRQLLEERISEQLEGQRQEQALQRYHSEAEELDHWLLSTRATLSSALKPLNEDLD
MEEQLIDCQNMLLEIEQKVSYLSELSVHSESLLLEGRAETKGEAEQLTLKLRSLKDSLVE
LQQMLQDKQVDIQGSLQEQEDSEPDSSLSQSPNVQDWLSHARSTRTQQHHDNLLRQRELQ
HQVAEQRKLLQSVANFGEELLNNQTLNGDRIKQPASLPHRVLLDSETVCPADQLRQRWEN
LNKDQSTKLQLSLNSLEQDQLSPVLLWSRLSSPSLVFKGEPLGQDSLSPRALFETCSQTL
QRITQEVKYGCLYPEQQLYSAVSAASSWLDAAENQLLSGPVLLSENTETQLTNFECLNRQ
LKIMSREVNLCRDLMAGGAGRQCGRDEQVLMEDTLEGLQERMGLLESTLVQYCDSMKDRL
QDHSHVQNELRVLFAALSEHKHQLLKKMAGTVDRPASKQLETLSEVEDSLKEFEQRVAEL
KTRADGLQSDHIANQELLKLQDAYEELVLMVGSRRSSLNHGLSLKAQYEAALHDLTNLVD
TAQDKMAADQKMTVTSVKEVQMLLDKHKEFFQGLECHMILTQTFYSKVCGLVAQRESQVL
EETMALAQSVLKQAHRRGVELEGIQESWSRLVENYQALCRQLEAVECSIPTVGLVEETEE
RLVERISLYQHLKTSLMEHQPQLYQVLEEGKRLLLSVGCVDLENQLTQLGEHWLSSTTKV
NKELHRLDSTLKHWSRYQNESAELSHWLQSAVDRLEFWTAQSVTVPQELETVRDHLCAFL
EFSKEVDAKSSLRSSVLNTGNQLLRLKRVDTAGLRSAMGQIDTQWAELLTHIPVVQEKLH
QLQMEKLASRHAITELMSWISLMENIIEGDQDKIQAVLGSEKVQEFLQKYKGFRIDLTCK
QLTVDFVNQSVLQMSSHDVEGKRSDKTDFAEKLGAMNRRWQILQGLIGEKIQHLEGLLES
WMEHESGVQALKTWLTLQEEKLKKRNRIEDVASVQNALKDCHELEELVKEKEKDLEKAEE
RGNALIQKENGSACSVVRETLKGLKQSWARLDQMIIQKKGNLRLVLEQWTLYRRASEEIN
GYLMEGRYSVSRLRLLNGSLEAVQQQVESLEGLQEEMDKQESSLRKFGTVTHQLLTECHP
SVAETLNRALHDVNIKWNHLLEQISVQLKIGKDLQGLWQRYKLLHSQCVAGVRRQEECAD
RLLKSATEREITEEESSAWMKDCSACLGGQASVQQSLQHLQTLGDQLKCLVDASSSAAIQ
SDLLALTYHLAKLEHSLQRQQETLQSESQACEGFRKQLNVLIGQAEEAEEVLKQSDPVGS
SEVALVQKKMEKLRVHLLKLSSLSPDLERINELVYRLPVSDSDVKRLQNLNRNWAAHTAH
LNERFSKLQSVVLQQQSFLQKCETWMEFLTQTEQKLTAEISGNYQSLLEQQRDHELFQAE
MFSRQQILYSIINDGHHILDQGSVDDRDDFSVKLALLSNEWQGVVRRAQQRRGIIDSLVR
QWQNYQETTEKLQRWLQEVSRDPSVYQPGEPVALLQARNLLDEIQQRERVLHRQQGSYIL
TVEAGMSLLLSADAVSESSLQAELMEIQERWRHAHHRLDQQRRELQGLIKNWERCEKGIN
TSMEKLKVFKMKLSVPLPDNHEELHLEQIRCK
Download sequence
Identical sequences H2VBB3
ENSTRUP00000046505 31033.ENSTRUP00000046505 ENSTRUP00000046505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]